CAZyme Information: MGYG000004271_01342

Basic Information

• Species: Roseburia sp900542495
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Roseburia; Roseburia sp900542495
• CAZyme ID: MGYG000004271_01342
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
815	MGYG000004271_9|CGC2	88925.81	4.6154

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004271	3205451	MAG	China	Asia

• Gene Location: Start: 91559; End: 94006 Strand: -

Full Sequence      

MEEKMLYKDASQPVEARVEDLLSRMTLEEKAAQLCGDLAASFIVDGKLSHEALVEKFKDG
HGRITQYSLVGLVDPKQIAEITNELQDFFVNETRLGIPVALQSENLCGYPGAGGTLFPSQ
MNVGSTWKPELAEEMSSIIGQESRAVGITSAMSPVIDVSRDPRWGRTYETYGEDQYLISQ
MGINYVRGMQNQGVSCIAKHFLGYAETQAGLNTATTRLNDRELYEVFATPFEAADKEAGL
DAMMANYAEIDGLPVIDNKKIARTLLRDTMGFEGMLTSDGAAVMKSWNYFKVANSYNEAG
LLAKKAGCDTEIPVGASFRNLPNYVRSGELDEAVLDESVRRILTIKFKRGLFENPYCEVE
KLEEAMSNAGKEEISKRIAEESMILLKNDGTLPLKKGTKVAVIGPHADSLRYPVSGYTYP
AYIEMMDAARKKDATVTFNGIIDEQAKAEAEEKAPKGPFDTMFEMFDEASMRSLDDMNGV
LRKLHTRSLKEVLSERFETVYAEGCKIIDESEEGFKDAVKAAENSDVVVMALGGNCGWVN
VTGGEGKDRQSLELPGVQEKLLETVAAVGKPVIVVLYGPGIFSVNWAKEHAAGIIQAWMP
GPFAGEAVTDVLDGTLNPGGKLTVTVPRSVGQVPMFYNHKNGSGYASGADATSATIFSGG
YVDADSTPLFSFGFGLSYTSFAVGDLEVRAKEVPTDGKIEVSCKVSNTGAVAGDEVVQLY
QAFQGAHVVRPNKQLAGFKRVHLNPGETKQLTFYLDIAQLGYYDEEMEFVVEPGQLDLMV
GTSSADLPLRETIRLTGTKTNVLGRRAYTCKVDEK

Enzyme Prediction     

No EC number prediction in MGYG000004271_01342.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	91	312	1.9e-60	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	2.11e-146	12	786	32	756	beta-glucosidase BglX.
COG1472	BglX	4.81e-76	25	419	1	373	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	1.02e-66	26	345	1	316	Glycosyl hydrolase family 3 N terminal domain.
PLN03080	PLN03080	3.16e-63	9	781	44	769	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	1.38e-48	383	678	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QAT49116.1	0.0	6	812	3	814
QQA37498.1	0.0	7	813	4	803
SNU95883.1	3.89e-309	4	809	3	803
AFM44649.1	7.88e-209	3	813	7	787
ABY95679.1	4.82e-206	6	815	4	784

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5YOT_A	5.15e-120	2	787	2	748	Isoprimeverose-producingenzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]
7EAP_A	3.91e-119	2	787	2	748	ChainA, Fn3_like domain-containing protein [Aspergillus oryzae RIB40]
5XXL_A	2.73e-111	5	795	1	753	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	1.46e-110	5	795	1	753	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]
5Z87_A	2.01e-109	7	787	36	777	ChainA, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KMH0	5.07e-124	76	796	48	721	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
T2KMH9	5.79e-120	7	786	29	746	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
Q56078	3.06e-104	15	785	35	755	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
P33363	1.63e-103	15	785	35	755	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
P14002	6.20e-81	115	798	68	671	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000070	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004271_01342.