CAZyme Information: MGYG000004272_00723

Basic Information

• Species: UMGS915 sp900546795
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Megasphaeraceae; UMGS915; UMGS915 sp900546795
• CAZyme ID: MGYG000004272_00723
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
376	MGYG000004272_15|CGC1	41200.48	7.7972

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004272	1866208	MAG	China	Asia

• Gene Location: Start: 31283; End: 32413 Strand: -

Full Sequence      

MKIMFSVGEASGDVHGASVAAAIKKAAPDAELFGMGGGKMAESGVRIIYDIKNLGFIGVA
EIIKKIPFFFRLRDTLAEAMKKERPDVLVCIDYPGFNMRLMKTAKKLGIPVVYYILPTIW
AWHKSRGKDIARYADGVASIFPFEAKAYEEIGAPVTFVGHPLLDIVKASMSKEETRHTMG
IPEGKRAILLMPGSRKQEVQSLFPVMLQAAEALQRQYDDLCFVVPRASTISLKMLTEQLE
KAAIPYVITEGKQYDVMNVCTAAVAASGTATLETALMELPTVLIYKVAPLTYRLAQILVN
IKMIGLPNIVAGREIIPEFLQDEATPEHVAGALRRLLDDEEYRNTMKLELAGVKTALGDP
GAVSRVAELILTIAKE

Enzyme Prediction     

No EC number prediction in MGYG000004272_00723.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	3	356	1.8e-127	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	1.59e-148	1	375	2	376	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	3.59e-131	1	376	2	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	1.02e-105	3	348	1	350	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	6.96e-92	3	371	8	383	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	7.68e-63	1	327	2	307	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVO26605.1	1.20e-152	1	376	1	376
ALG41186.1	3.23e-150	1	376	1	376
CCC72315.1	4.58e-150	1	376	1	376
AVO73783.1	4.58e-150	1	376	1	376
SNV60281.1	7.54e-148	1	376	1	376

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	1.89e-61	1	346	7	354	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	1.04e-60	1	346	7	354	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B3E4H8	2.78e-101	2	376	8	382	Lipid-A-disaccharide synthase OS=Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) OX=398767 GN=lpxB PE=3 SV=1
Q74AT9	2.87e-101	2	371	8	377	Lipid-A-disaccharide synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=lpxB PE=3 SV=1
Q39T49	1.68e-97	2	371	8	377	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
Q2LVL8	6.70e-94	3	376	6	380	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
Q1D393	1.74e-88	2	373	6	377	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000031	0.000017	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004272_00723.