CAZyme Information: MGYG000004272_01223

Basic Information

• Species: UMGS915 sp900546795
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Megasphaeraceae; UMGS915; UMGS915 sp900546795
• CAZyme ID: MGYG000004272_01223
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
530	MGYG000004272_38|CGC1	61339.48	9.2079

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004272	1866208	MAG	China	Asia

• Gene Location: Start: 2311; End: 3903 Strand: -

Full Sequence      

MKRFSWPCLLLGLLAFLFFIYGSASLPVTDPVESNYALTAKEMVLSGDWISPRIYGNYWY
DKPILIYFFLCISYSIFGFTDFASRLPSALFGAFTIALIYWFMHRQYRKQILAVLAAAMT
ATSLEVWIISHGIITDALLFFFTCATMFFAYIGLTEHKTRWTAAAYGMAGFAALTKGPVG
LVLPGLLLLVWVCLHRQTLPLRRLFPLAGIGLFLLIAAPWYTVMYLKHGEEFITTFLGLH
NYLRATVSEHPKDNVWYYYLVLVPVSLLPWAGLSLYGLWKLRSKALDYTFLAVWSLGTVL
FYSLMATKYPTYSYIANAPLLLLGALALDRILERENSRLWLFLTVPTLFLWLLWTAGSFF
APWGDWILLYLFAPFAFICYLLAHYRKGFMALPILTVIGTIVFSCLVISEALVPFTQYRS
FESRQQIAQQYPYPMYALGNYRASYAFYTGQVMTAVRYQNPYEEERSKVWEGKWTMPAID
IEQLELEKDKRKPFIITVSGKDKEILKNYPIYEKLRIIYVLEKETWFLYK

Enzyme Prediction     

No EC number prediction in MGYG000004272_01223.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	5	495	3.3e-96	0.9481481481481482

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	1.09e-31	20	376	22	392	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	2.15e-22	31	312	31	317	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam13231	PMT_2	2.81e-14	61	220	1	157	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
pfam02366	PMT	1.30e-05	33	221	32	231	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
COG4745	COG4745	0.002	47	176	46	177	Predicted membrane-bound mannosyltransferase [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXL21032.1	1.28e-164	10	478	9	485
AXB83023.1	1.46e-164	9	484	8	491
ALG41393.1	4.13e-144	15	478	14	483
CCC72525.1	8.26e-144	15	478	14	483
AVO73980.1	8.26e-144	15	478	14	483

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	4.99e-26	28	335	54	371	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A4SQX1	3.78e-30	1	336	1	339	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Aeromonas salmonicida (strain A449) OX=382245 GN=arnT PE=3 SV=1
A0KGY4	3.11e-29	27	336	24	339	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049) OX=380703 GN=arnT PE=3 SV=1
A1JPM4	1.27e-26	30	329	31	336	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) OX=393305 GN=arnT PE=3 SV=1
B2K5L1	3.08e-26	10	329	11	336	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) OX=502801 GN=arnT PE=3 SV=1
Q1CIH9	3.08e-26	10	329	11	336	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Yersinia pestis bv. Antiqua (strain Nepal516) OX=377628 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.968359	0.029269	0.001983	0.000060	0.000050	0.000286

TMHMM  Annotations     

start	end
7	29
63	80
82	101
111	130
137	154
169	191
204	226
255	277
289	306
310	332
339	361
366	385
392	414