CAZyme Information: MGYG000004279_00145

Basic Information

• Species: UMGS1484 sp900552285
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UMGS1484; UMGS1484 sp900552285
• CAZyme ID: MGYG000004279_00145
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
315	MGYG000004279_6|CGC1	34775.88	9.8534

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004279	1699873	MAG	China	Asia

• Gene Location: Start: 5258; End: 6205 Strand: +

Full Sequence      

MAYTNSPLVSYTKLSPNHSGQRTHSIDRITPHCVVGQCSVETLGNIFLPTSRQASSNYGI
GVDGRVGMYVEEKNRSWCSSSAANDQRAVTIECASDNTEPYAFKDVVHKRLIELCTDICR
RNGKTKLLWLGDKTKTLNYTPKSDEMVLTVHRWFANKSCPGNWMYARMGDLASKVTAALG
SEVKPADPVKPTGPIKVGDLVTITGSTYYNGKAIPGWVKKLRWYVVEVSGDRTVINKDEF
GKYAIMSPVKTSALAVAGTKPSEDYRIHTVVHGDTLWAIAKKYLGNGSRYKEIVSLNGLK
SNVIYSGMKLKIPNK

Enzyme Prediction     

No EC number prediction in MGYG000004279_00145.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK11198	PRK11198	1.99e-13	256	313	86	146	LysM domain/BON superfamily protein; Provisional
pfam01476	LysM	1.19e-12	268	313	1	43	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.
pfam01510	Amidase_2	4.07e-12	26	162	2	121	N-acetylmuramoyl-L-alanine amidase. This family includes zinc amidases that have N-acetylmuramoyl-L-alanine amidase activity EC:3.5.1.28. This enzyme domain cleaves the amide bond between N-acetylmuramoyl and L-amino acids in bacterial cell walls (preferentially: D-lactyl-L-Ala). The structure is known for the bacteriophage T7 structure and shows that two of the conserved histidines are zinc binding.
cd00118	LysM	1.33e-09	266	312	1	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
smart00257	LysM	2.43e-08	267	312	1	44	Lysin motif.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUO22979.1	6.11e-106	1	314	184	505
AFB75734.1	2.76e-104	1	314	184	505
ADB89215.1	7.45e-97	1	182	11	192
CBL18646.1	5.72e-92	1	181	3	183
AFB76124.1	6.14e-72	4	313	7	241

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000028	0.000003	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004279_00145.