CAZyme Information: MGYG000004281_00166

Basic Information

• Species: Parabacteroides sp900552465
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides sp900552465
• CAZyme ID: MGYG000004281_00166
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase D

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
324	MGYG000004281_1|CGC5	36314.49	7.6006

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004281	4813571	MAG	China	Asia

• Gene Location: Start: 202939; End: 203913 Strand: -

Full Sequence      

MKLLNNNSIAGFIAGGAVCLTACLSIGSIDSEKVKEERPVVSSVTMSPDVPSSASFCGKE
IDLTRYNMHEGMDRELSSFTYFHSTTMLLVKRANRYFPVIEPILKANGIPDDFKYLAVIE
SHLDPRVSSPARAVGTWQLLEGTAKQYGLTITPTVDERCDVAKATEAACRYLKAAYDKYG
DWATVAASYNAGMGRISGELTKQEADSSFDLWLVEETTRYVYRIMAIKQIFEAPYKYGFV
LRAQDLYKPIACENVSVSTDIQDLSAFAQKNGATYADLKRFNPWLRDRKLLTLGKTYTIQ
IPKESDMYYKTPNTYVHNPAWVVK

Enzyme Prediction     

No EC number prediction in MGYG000004281_00166.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	96	231	6.5e-23	0.9037037037037037

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16894	MltD-like	7.82e-56	104	229	1	129	Membrane-bound lytic murein transglycosylase D and similar proteins. Lytic transglycosylases (LT) catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc). Membrane-bound lytic murein transglycosylase D protein (MltD) family members may have one or more small LysM domains, which may contribute to peptidoglycan binding. Unlike the similar "goose-type" lysozymes, LTs also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
PRK10783	mltD	3.80e-24	66	283	78	293	membrane-bound lytic murein transglycosylase D; Provisional
pfam01464	SLT	2.21e-19	99	196	1	99	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd00254	LT-like	2.92e-16	116	226	5	108	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	2.02e-14	96	233	6	151	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT47799.1	4.41e-223	1	324	2	325
QUT53912.1	3.16e-189	1	323	1	324
QKH97149.1	6.38e-189	1	323	1	324
QRO17228.1	6.38e-189	1	323	1	324
QCY56027.1	6.38e-189	1	323	1	324

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AEZ7	1.16e-23	17	304	10	310	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli (strain K12) OX=83333 GN=mltD PE=1 SV=1
P0AEZ8	1.16e-23	17	304	10	310	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=mltD PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000007	0.000013	1.000013	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
7	29