CAZyme Information: MGYG000004281_00828

Basic Information

• Species: Parabacteroides sp900552465
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides sp900552465
• CAZyme ID: MGYG000004281_00828
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1137	MGYG000004281_7|CGC2	128090.25	6.5151

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004281	4813571	MAG	China	Asia

• Gene Location: Start: 26266; End: 29679 Strand: -

Full Sequence      

MCIYFRCKRVLFGVGLMLSLSLGLQAQHKDMQRVATNDCGVASAQEFLIKGDDYTLPDSF
TGSKEAKTCNFGGTVIYAFDQMDIQADYQMEVVYLADSRREQRIVADGNEVQTPVVLEKG
KEQRYVIDLPKKAYAYGQLVLVFEALKGDNAIVSELNLYSSNPTRLKPFGEERKKELVHT
QAYTVDTAVCAEKVLPIYTIKPHQVAGVYNPVLSLNGTWLFNEKPDARFYEQKLDNGNWK
PIVVPGQWSMQGFKVDSAGFGAYRTTFTLPADWQGKQVKLRFDGVSSESVVYLNGKEIGS
HMGGMTAFDLDVTKALKAGENSLALKVRSESLADMLGSLTQYAAHQLGGITRKVTLFAVP
EIHLADLRIVTDLDDAYKDADLKVYVSVANSSGSVRKDVSVRLSISGLPVVLNQNIPEIA
AGSVWNGWLTGKVASPRKWDNEHPDLYTLKLEVGTSDKVVEQVEKRFGFREVQIQGNRLL
VNGKAVKLRGVCRHEMHPLTGRVMNPELERKDVELYRDANCNFIRTSHYPPCEELLDICD
ELGMFVEVEAPVCWIGHHANENWKVLNYRSPEYYPYVLQANMEMIQFYRNHPSILFWSMA
NESYWNKEFAQVQVYMEKADPTRPFTFHDQAYGGFNNQGSTAPIANIHYPGPNGYKVAAK
SDRPMTYGEYCHLNVYNRSELVTDPGIRSDWALALAPTWDNMYKTPGVLGGSIWSGIDDI
FQMPNGDAVGYGPWGPIDGWRRPKPEYWDMKKIYSPVRVETKALSPSGELVIDLENRYTY
TNLNELRINWSYGEEKGTAFVDLKPGEKGQFRVQIAHPEKANELYLSFVDPRGFTTDEYL
IPVGRQVQNELQALPAVPTRLKEKKDRYVITGKDFTCEISRVSGQILSVRKGKTEILNGG
PWLMALPLTGGGCFPNHNANTPVFNDLCSDWQVEKVEAVQQGNDAVIKVAGTYKEFAGSY
DLKVNANGELSVAYSFNALEDVNPRQWGLVFEAPASFDKTFWRRDGLWSVYPSDHISRPV
GEASLFYEGLPAKVDPRTEPAWSWSMDYNELGSNDFRSTRRNIWYAGLKDGKGNKVTACS
NGGQHWRSWLEKDKIRFLVADFVTAGNEMFLSSYYAPYRKPVKKGEQIGGKIEVRVE

Enzyme Prediction     

No EC number prediction in MGYG000004281_00828.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	209	1012	6.1e-137	0.9534574468085106

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10340	ebgA	4.83e-91	213	903	42	761	cryptic beta-D-galactosidase subunit alpha; Reviewed
COG3250	LacZ	1.90e-76	211	627	11	431	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK09525	lacZ	1.15e-58	214	624	54	484	beta-galactosidase.
PRK10150	PRK10150	2.23e-56	212	627	12	447	beta-D-glucuronidase; Provisional
pfam02836	Glyco_hydro_2_C	6.26e-40	472	757	1	300	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT50207.1	0.0	7	1137	7	1137
QRO24898.1	0.0	6	1136	2	1123
AQT68269.1	1.35e-296	48	1134	46	1211
BBE16084.1	3.90e-284	192	1132	33	981
AOM75904.1	4.54e-264	13	1137	9	1122

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6S6Z_A	6.29e-65	213	825	39	662	Structureof beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_B Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_C Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_D Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_E Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_F Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_G Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_H Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8]
6SD0_A	6.33e-65	213	825	40	663	Structureof beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_B Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_C Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_D Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8]
3BGA_A	9.66e-62	214	1061	50	932	Crystalstructure of beta-galactosidase from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482],3BGA_B Crystal structure of beta-galactosidase from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482]
3DEC_A	6.84e-61	214	1042	46	911	ChainA, Beta-galactosidase [Bacteroides thetaiotaomicron VPI-5482]
6ZJV_A	3.93e-48	211	760	56	610	Cold-adaptedbeta-D-galactosidase from Arthrobacter sp. 32cB mutant D207A [Arthrobacter sp. 32cB],6ZJW_A Cold-adapted beta-D-galactosidase from Arthrobacter sp. 32cB mutant D207A in complex with galactose [Arthrobacter sp. 32cB],6ZJX_A Cold-adapted beta-D-galactosidase from Arthrobacter sp. 32cB mutant D207A in complex with saccharose [Arthrobacter sp. 32cB]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q56307	3.47e-64	213	825	40	663	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2
O52847	4.74e-60	214	1002	60	900	Beta-galactosidase OS=Priestia megaterium (strain DSM 319 / IMG 1521) OX=592022 GN=bgaM PE=3 SV=1
T2KPJ7	1.67e-53	214	609	55	437	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
P23989	1.93e-49	214	903	47	786	Beta-galactosidase OS=Streptococcus thermophilus OX=1308 GN=lacZ PE=3 SV=1
P06864	6.04e-49	213	885	42	743	Evolved beta-galactosidase subunit alpha OS=Escherichia coli (strain K12) OX=83333 GN=ebgA PE=1 SV=4

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.006365	0.990720	0.002191	0.000316	0.000202	0.000200

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004281_00828.