CAZyme Information: MGYG000004281_01083

Basic Information

• Species: Parabacteroides sp900552465
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides sp900552465
• CAZyme ID: MGYG000004281_01083
• CAZy Family: GH28
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
489	MGYG000004281_10|CGC1	53923.5	8.0698

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004281	4813571	MAG	China	Asia

• Gene Location: Start: 9522; End: 10991 Strand: -

Full Sequence      

MKILKKIVMMCFLIGAVAPLWAKDYQMTMFGIKSDGTTMNTRSIQKAIDFISENGGGRLM
FSVGRYLTGSIHLKSNVTIHLGEGAVLVGSTNPYDYDMELNAWYGLILANKQDNIGITGK
GVIDGRGRELANNYISQVYSGVINDKLQLGRVANRPKLVYFRECKNVEVKGITLMNPAFW
TQTYDQCENLLIDGITVHSRAYWNNDGMDIVDCNGALIQNCYVDATDDAICLKSHSADAI
CQNIEVRNNTACSSASGIKFGTASTGGFKNIKIINNTVFDTFRSAITIQAVDGGLVENVI
VDSLRSINTGNPIYLVVGERREGRRSRMDNVHISNVYAEVPATKPDAGYEYEGPTEDNPR
NISPSGIVGLKDNKITNVSIENVEIVYPGGGNPLYAKVGLDELDKVPEMPKAYPEFSQHK
ELPAWGFYVRHADGVTFRNVKLTALKKDYRPAIVLDDVNNGTFTKIKVTEPSAGKKEKIH
AYKSTNIKK

Enzyme Prediction     

No EC number prediction in MGYG000004281_01083.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	54	391	2.4e-59	0.916923076923077

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG5434	Pgu1	8.41e-51	28	312	86	401	Polygalacturonase [Carbohydrate transport and metabolism].
pfam00295	Glyco_hydro_28	6.40e-14	107	281	48	210	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
PLN02218	PLN02218	1.79e-08	30	313	73	349	polygalacturonase ADPG
PLN02793	PLN02793	7.73e-08	30	313	58	334	Probable polygalacturonase
PLN03003	PLN03003	1.89e-05	27	267	26	244	Probable polygalacturonase At3g15720

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT49879.1	0.0	1	489	1	489
BCG53468.1	3.51e-215	1	489	14	503
AEW21978.1	2.69e-195	1	487	1	489
BAR50762.1	3.81e-195	1	487	1	489
BAR48035.1	1.09e-194	1	487	1	489

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MXN_A	3.35e-40	23	254	20	245	Crystalstructure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184],4MXN_B Crystal structure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184],4MXN_C Crystal structure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184],4MXN_D Crystal structure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184]
5OLP_A	1.64e-29	23	386	43	441	Galacturonidase[Bacteroides thetaiotaomicron VPI-5482],5OLP_B Galacturonidase [Bacteroides thetaiotaomicron VPI-5482]
3JUR_A	4.16e-24	23	313	26	355	Thecrystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_B The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_C The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_D The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima]
2UVE_A	6.89e-16	30	379	162	581	Structureof Yersinia enterocolitica Family 28 Exopolygalacturonase [Yersinia enterocolitica],2UVE_B Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase [Yersinia enterocolitica],2UVF_A Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase in Complex with Digalaturonic Acid [Yersinia enterocolitica],2UVF_B Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase in Complex with Digalaturonic Acid [Yersinia enterocolitica]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P15922	2.71e-14	23	294	150	469	Exo-poly-alpha-D-galacturonosidase OS=Dickeya chrysanthemi OX=556 GN=pehX PE=1 SV=1
A7PZL3	2.01e-12	30	323	68	346	Probable polygalacturonase OS=Vitis vinifera OX=29760 GN=GSVIVT00026920001 PE=1 SV=1
P35338	9.61e-07	24	315	40	322	Exopolygalacturonase OS=Zea mays OX=4577 GN=PG9 PE=2 SV=1
P20041	1.55e-06	35	313	63	393	Polygalacturonase OS=Ralstonia solanacearum OX=305 GN=pglA PE=1 SV=1
P35339	1.69e-06	24	276	40	274	Exopolygalacturonase OS=Zea mays OX=4577 GN=PG2C PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000311	0.998916	0.000227	0.000171	0.000170	0.000161

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004281_01083.