CAZyme Information: MGYG000004281_01085

Basic Information

• Species: Parabacteroides sp900552465
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides sp900552465
• CAZyme ID: MGYG000004281_01085
• CAZy Family: GH28
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
250	MGYG000004281_10|CGC1	26879.64	5.9698

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004281	4813571	MAG	China	Asia

• Gene Location: Start: 13918; End: 14670 Strand: -

Full Sequence      

MNVNKLFASVTGLLLFAASLSAKDYQVSMFGIQSDGVTLNTRSIQRAVDYISEQGGGRLV
FYVGRYLTGSIELKSNVTIRIEEGAALVAVPSVYDFKGANGCNALIYADKQKNIGIGGKG
IIEGRNKAVRASIEEQLQKGHIKGNVPDYAPALICLDGCEDVKIEQITLQDACNTAGIYK
DCRNVTIDKVVVNAQTSESKAIFISGCDGLKMTDCYFNMTVDPLQTAGTSRNLTFTDCFT
PDGKAVSTDK

Enzyme Prediction     

No EC number prediction in MGYG000004281_01085.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	53	240	8.7e-23	0.5415384615384615

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG5434	Pgu1	9.79e-19	27	238	85	364	Polygalacturonase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EDN88021.1	9.23e-149	1	250	1	250
QUT49881.1	2.64e-148	1	250	1	250
SCM56501.1	4.69e-70	3	244	1	243
BBD44717.1	3.06e-68	14	250	12	249
BCG53463.1	1.58e-55	20	250	21	252

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MXN_A	1.27e-135	23	250	20	247	Crystalstructure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184],4MXN_B Crystal structure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184],4MXN_C Crystal structure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184],4MXN_D Crystal structure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184]
3JUR_A	1.38e-10	30	124	33	135	Thecrystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_B The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_C The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_D The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima]
5OLP_A	2.51e-10	23	123	43	153	Galacturonidase[Bacteroides thetaiotaomicron VPI-5482],5OLP_B Galacturonidase [Bacteroides thetaiotaomicron VPI-5482]
2UVE_A	4.54e-07	18	137	148	286	Structureof Yersinia enterocolitica Family 28 Exopolygalacturonase [Yersinia enterocolitica],2UVE_B Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase [Yersinia enterocolitica],2UVF_A Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase in Complex with Digalaturonic Acid [Yersinia enterocolitica],2UVF_B Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase in Complex with Digalaturonic Acid [Yersinia enterocolitica]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7PZL3	9.06e-08	18	216	54	266	Probable polygalacturonase OS=Vitis vinifera OX=29760 GN=GSVIVT00026920001 PE=1 SV=1
P15922	3.18e-07	23	137	150	279	Exo-poly-alpha-D-galacturonosidase OS=Dickeya chrysanthemi OX=556 GN=pehX PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000323	0.998907	0.000207	0.000178	0.000175	0.000171

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004281_01085.