CAZyme Information: MGYG000004281_01203

Basic Information

• Species: Parabacteroides sp900552465
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides sp900552465
• CAZyme ID: MGYG000004281_01203
• CAZy Family: GH16
• CAZyme Description: Keratan-sulfate endo-1,4-beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
262	MGYG000004281_11|CGC2	29822.64	4.5567

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004281	4813571	MAG	China	Asia

• Gene Location: Start: 54271; End: 55059 Strand: +

Full Sequence      

MKQGLFALGLSIALSLMAGCQPRKSGWKLVWEENFDQTEHFDEASWSKIPRGTSDWNNYM
SDFDSCYGMRDGNLVLRGLVNYSLPADTAPFITGGVYSRGKVGFSDGRLDIRAKLYGAIG
AWPAFWLLPENEGWPEGGEIDIMERLNNDTIAYQTVHSAYTHILGIKDNPKQGGIGPINR
DDYNVYSVEMYRDSLVFFINDTRTFAYPRIETDKEGQFPFTDKKFYLLLDMQLGGSWVGA
VEPADLPVEMEIDWVRFYQKEK

Enzyme Prediction     

No EC number prediction in MGYG000004281_01203.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	31	258	7.7e-49	0.9956521739130435

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd08023	GH16_laminarinase_like	3.02e-67	31	258	1	235	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
cd00413	Glyco_hydrolase_16	2.61e-21	33	258	1	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
cd02182	GH16_Strep_laminarinase_like	1.00e-18	26	259	1	259	Streptomyces laminarinase-like, member of glycosyl hydrolase family 16. Proteins similar to Streptomyces sioyaensis beta-1,3-glucanase (laminarinase) present in Actinomycetales as well as Peziomycotina. Laminarinases belong to glycosyl hydrolase family 16 and hydrolyze the glycosidic bond of the 1,3-beta-linked glucan, a major component of fungal and plant cell walls and the structural and storage polysaccharides (laminarin) of marine macro-algae. Members of the GH16 family have a conserved jelly roll fold with an active site channel.
COG2273	BglS	1.67e-15	3	258	16	263	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].
pfam00722	Glyco_hydro_16	1.30e-14	69	256	8	168	Glycosyl hydrolases family 16.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT49638.1	5.87e-183	1	262	1	262
ANQ62168.1	1.76e-134	18	262	20	264
AKA53756.1	1.02e-133	18	262	20	264
QUU04914.1	1.44e-133	18	262	20	264
CBW24642.1	1.44e-133	18	262	20	264

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6T2R_AAA	2.58e-102	27	259	29	262	ChainAAA, Beta-glycosidase [Bacteroides caccae]
3ILN_A	3.57e-31	27	259	5	248	ChainA, Laminarinase [Rhodothermus marinus],3ILN_B Chain B, Laminarinase [Rhodothermus marinus]
6T2O_AAA	1.17e-26	42	256	51	271	ChainAAA, Glycosyl hydrolase family 16 [Bacteroides caccae ATCC 43185],6T2O_BBB Chain BBB, Glycosyl hydrolase family 16 [Bacteroides caccae ATCC 43185]
6T2P_AAA	3.16e-26	42	256	51	271	ChainAAA, Glycosyl hydrolase family 16 [Bacteroides caccae ATCC 43185],6T2P_BBB Chain BBB, Glycosyl hydrolase family 16 [Bacteroides caccae ATCC 43185],6T2Q_AAA Chain AAA, Glycosyl hydrolase family 16 [Bacteroides caccae ATCC 43185],6T2Q_BBB Chain BBB, Glycosyl hydrolase family 16 [Bacteroides caccae ATCC 43185]
6T2S_AAA	2.00e-25	42	256	16	236	ChainAAA, Glycoside hydrolase family 16 protein [Bacteroides finegoldii DSM 17565],6T2S_BBB Chain BBB, Glycoside hydrolase family 16 protein [Bacteroides finegoldii DSM 17565],6T2S_CCC Chain CCC, Glycoside hydrolase family 16 protein [Bacteroides finegoldii DSM 17565]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9ZG90	9.57e-47	27	259	56	288	Keratan-sulfate endo-1,4-beta-galactosidase OS=Sphingobacterium multivorum OX=28454 PE=1 SV=1
P45798	6.60e-34	1	259	13	283	Beta-glucanase OS=Rhodothermus marinus OX=29549 GN=bglA PE=1 SV=1
C1IE32	3.71e-13	16	245	9	247	Glucan endo-1,3-beta-glucosidase OS=Cryptopygus antarcticus OX=187623 PE=1 SV=1
Q8N0N3	7.70e-10	104	236	144	303	Beta-1,3-glucan-binding protein OS=Penaeus monodon OX=6687 PE=2 SV=1
O33680	1.39e-07	107	258	319	457	Endo-1,3-1,4-beta-glycanase ExsH OS=Rhizobium meliloti (strain 1021) OX=266834 GN=exsH PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000001	0.000893	0.999145	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004281_01203.