CAZyme Information: MGYG000004281_02489

Basic Information

• Species: Parabacteroides sp900552465
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides sp900552465
• CAZyme ID: MGYG000004281_02489
• CAZy Family: GT51
• CAZyme Description: Penicillin-binding protein 1C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
779	MGYG000004281_32|CGC2	87100.24	7.7409

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004281	4813571	MAG	China	Asia

• Gene Location: Start: 55201; End: 57540 Strand: +

Full Sequence      

MFYLFFIKLLIWTVMYLVAPRTLFTESCSTLLYSSEGQLLGARIAPDGQWRFPPADSIPE
KFTTCLLVYEDKRFYRHPGVDPIALARAVRLNFAARRVVSGGSTVTMQLARIARDNRNRT
LYEKAVETSWALLLETAYSKNEILNLYASHAPFGGNVVGIEAAAWRYFGRSASELSWAES
ATLAVLPNSPALIHPGRNRKQLKAKRDKLLATLKESDILDQTTYELACMEPLPEAPVPLP
DEAPHLLERLAADAPGTRITTSVRQMLQRQAQAIVNRYARDYSSNYIHNLAALVTDTETG
EVLAYAGNVTFRADDRKGNQVDIITSPRSTGSILKPFLYAAMLHEGQLLPGTLVSDVPLN
INGFTPQNYNKTFYGAVPAHRAIERSLNVPLVRMLSLYNTGRFMSLLKKSGMTTLRFSEE
HYGASLILGGAEGTLWDLTGMYASLARTLSHYRPYNGRYNPADIHPLTPFPAHDDRPVRS
VADPRLTDRPLLSAASIWFTFEAMSALNRPEEEADWQQFESMKQVAWKTGTSYGGRDAWA
IGTTPHYTIGIWVGNASGEGRPGLTGVGNAAPVLFDLFSLLPGGNWFDMPYDELEPMAIC
RLSGHKASAICDQVDTLYMPRSGNGTAVCPYHRLVHLSADGRFRVNSSCESVDRMITRPW
FVLPPSQEYYYRNYHIDYTPLPPVKPGCAPEQSRQIELIYPEHNAILYLPKGFSGKPEKF
IFKAAHARPDATLYWHLDDTYLGETTDSHQIACQADPGKHLLTLTDNFGNQRKILFEVK

Enzyme Prediction     

No EC number prediction in MGYG000004281_02489.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	53	213	5.3e-49	0.903954802259887

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02073	PBP_1c	0.0	29	779	11	727	penicillin-binding protein 1C. This subfamily of the penicillin binding proteins includes the member from E. coli designated penicillin-binding protein 1C. Members have both transglycosylase and transpeptidase domains and are involved in forming cross-links in the late stages of peptidoglycan biosynthesis. All members of this subfamily are presumed to have the same basic function. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG4953	PbpC	1.58e-165	5	779	12	732	Membrane carboxypeptidase/penicillin-binding protein PbpC [Cell wall/membrane/envelope biogenesis].
PRK11240	PRK11240	2.73e-117	47	581	58	562	penicillin-binding protein 1C; Provisional
COG0744	MrcB	1.71e-93	29	599	55	615	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
TIGR02074	PBP_1a_fam	2.02e-89	51	573	2	520	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT47706.1	0.0	2	779	4	781
QRO17107.1	0.0	12	779	81	848
ABR42700.1	0.0	12	779	81	848
AST53363.1	0.0	12	779	81	848
QUR50918.1	0.0	12	779	81	848

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5FGZ_A	3.41e-32	45	394	150	523	E.coli PBP1b in complex with FPI-1465 [Escherichia coli K-12],5HL9_A E. coli PBP1b in complex with acyl-ampicillin and moenomycin [Escherichia coli K-12],5HLA_A E. coli PBP1b in complex with acyl-cephalexin and moenomycin [Escherichia coli K-12],5HLB_A E. coli PBP1b in complex with acyl-aztreonam and moenomycin [Escherichia coli K-12],5HLD_A E. coli PBP1b in complex with acyl-CENTA and moenomycin [Escherichia coli K-12],6YN0_A Structure of E. coli PBP1b with a FtsN peptide activating transglycosylase activity [Escherichia coli K-12],7LQ6_A Chain A, Penicillin-binding protein 1B [Escherichia coli K-12]
3VMA_A	3.66e-32	45	394	171	544	CrystalStructure of the Full-Length Transglycosylase PBP1b from Escherichia coli [Escherichia coli K-12]
3FWL_A	1.03e-30	45	394	154	527	CrystalStructure of the Full-Length Transglycosylase PBP1b from Escherichia coli [Escherichia coli]
2OQO_A	1.04e-30	56	227	26	197	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
3NB6_A	3.59e-30	56	227	26	197	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P76577	4.21e-88	20	581	33	564	Penicillin-binding protein 1C OS=Escherichia coli (strain K12) OX=83333 GN=pbpC PE=1 SV=1
Q9KUC0	4.96e-43	56	573	186	706	Penicillin-binding protein 1B OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=mrcB PE=3 SV=1
P45345	2.40e-39	54	576	172	699	Penicillin-binding protein 1B OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=mrcB PE=3 SV=1
Q4UK08	1.39e-35	30	579	49	714	Penicillin-binding protein 1A OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) OX=315456 GN=mrcA PE=3 SV=1
O66874	4.36e-35	32	554	47	639	Penicillin-binding protein 1A OS=Aquifex aeolicus (strain VF5) OX=224324 GN=mrcA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.485654	0.511809	0.001012	0.000382	0.000388	0.000729

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004281_02489.