CAZyme Information: MGYG000004281_02529

Basic Information

• Species: Parabacteroides sp900552465
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides sp900552465
• CAZyme ID: MGYG000004281_02529
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
387	MGYG000004281_34|CGC1	44057.8	5.5118

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004281	4813571	MAG	China	Asia

• Gene Location: Start: 17094; End: 18257 Strand: -

Full Sequence      

MKTIKYLSAGLSICACTCLVNNIPTQAETTSPAVTVTAAAWNRQSVMDVARKVADWQIKD
YPDNKYAQSEPRGWVPGALYMGMYDWAELSNDNTYYDWLKKIFNRQSWQVANRMYHADDV
CIAQTYIDFYNKEKNENMLKPTIARADWVVNNPSNGSMDLDYSKGSTIERWTWCDALFMA
PGVYTRLYTLTGNRKYMHFADGEFRATYNYLYDKDEHLFYRDSRYFDQREANGKKVFWGR
GNGWVIGGLAEILKTLPADDTEYRPFYIGLFKEMSERLAGLQGKDGYWHASLLDPDSYPS
PETSATGFIVYGLAYGINQGYLPADQYLPVVKKGWEALVAAVEADGKLGWVQPVGADPKK
VTREMTELYGPGAFLMAASEIYKLADK

Enzyme Prediction     

No EC number prediction in MGYG000004281_02529.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	67	383	4.8e-90	0.9759036144578314

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	1.02e-108	49	384	1	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	1.59e-54	43	385	5	357	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT48952.1	4.03e-266	3	387	56	441
QUT74307.1	7.77e-162	41	384	23	366
QIU93494.1	3.86e-156	41	385	26	371
ASM65072.1	7.76e-156	35	385	16	371
QUU06865.1	7.76e-156	35	385	16	371

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4CE7_A	2.17e-77	71	384	50	369	Crystalstructure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]
5NOA_A	1.63e-58	46	380	33	370	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	8.43e-51	120	380	102	353	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WF04	1.07e-82	44	381	51	408	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
T2KPL9	5.87e-79	71	386	55	377	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
L7P9J4	1.45e-76	71	384	57	376	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
O31521	1.36e-13	74	383	31	337	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000605	0.707923	0.290568	0.000309	0.000312	0.000257

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004281_02529.