CAZyme Information: MGYG000004281_02773

Basic Information

• Species: Parabacteroides sp900552465
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides sp900552465
• CAZyme ID: MGYG000004281_02773
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
352	MGYG000004281_41|CGC1	41169.06	6.3917

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004281	4813571	MAG	China	Asia

• Gene Location: Start: 9558; End: 10616 Strand: -

Full Sequence      

MSSESDLDNFPAGYTPKEIGTLISKRFIPGKHMFHKKNGRDGIHYAEVCTWYGALKYAVA
TKNNELFKQLQNRFEPLFTTEADHRPYMNHVDLNMFGCLPLEFYQITKDKRYLDLGIPYA
DTQWQVPDNATTEEKEWAKKGFSWQTRLWIDDMFMITIIQSQAYKSTGKREYIDRAAREM
VMYLDELQRPNGLFYHAPDVPFYWGRGNGWMAAGMTELLRYLPEDNPDRPRILEGYLLMM
RSLKEYQMPDGMWSQLVDDQACWPETSGTAMFTYAMITGVKLGWLDKKEYSPVARKAWMA
LVPYINKEGDVTEVCVGTNKKNDKQYYYDRPRITGDYHGQAPVLWCCFALME

Enzyme Prediction     

No EC number prediction in MGYG000004281_02773.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	39	350	1.6e-76	0.9668674698795181

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	2.73e-54	25	346	11	335	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	1.11e-50	40	344	31	347	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT51085.1	3.52e-226	33	352	1	320
QPH40458.1	1.16e-187	7	352	24	366
QDW23918.1	1.21e-187	1	352	19	367
QDO68157.1	5.70e-186	1	352	19	367
ALJ59885.1	1.63e-185	1	352	19	367

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3K11_A	2.17e-37	148	345	199	405	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]
1NC5_A	2.19e-24	44	344	40	358	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	9.41e-24	44	344	30	348	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
5NOA_A	2.69e-22	149	301	158	324	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	7.90e-20	149	298	141	304	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	1.20e-23	44	344	40	358	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P9WF04	1.05e-17	149	327	201	396	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
L7P9J4	3.73e-17	103	311	124	340	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
T2KPL9	1.90e-15	103	311	122	339	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
P0A3U6	2.54e-11	165	344	11	222	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000070	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004281_02773.