CAZyme Information: MGYG000004281_03390

Basic Information

• Species: Parabacteroides sp900552465
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides sp900552465
• CAZyme ID: MGYG000004281_03390
• CAZy Family: GH84
• CAZyme Description: O-GlcNAcase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
832		93529.81	5.8365

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004281	4813571	MAG	China	Asia

• Gene Location: Start: 70; End: 2568 Strand: -

Full Sequence      

MKLLNLTAALLLGGALQAQNPLPVIHPQPQEVTLSTNRLNAPHGFALSGIKNPDADAMRL
LRETLSITVQPDALPLKITMTEGQAPELKRSGAYRLDVTDNGITIATSDSRGLFYAAQTL
RQLVRMDEQGNQTLPVCSITDYPDVAFRGTVEGFYGDPWSHVDRIEQLRFYGKMKMNTYI
YGPKDDPYHSSPNWRKPYPEKEAAQIKDLVKEAAANKVDFVWAIHPGLDIQWTDEDRMNV
LNKFGMMYDLGVRSFAVFFDDISGEGAKADKQADLLNFLQKEFIEKKEGVSPLIMCPTEY
NRAWAGSDYLDVLGRTLDPAIHVMWTGNSVIHDITLEGQEWVNKRIQRPSYVWWNFPVSD
YCRDHLLMGPSYGLDPEAAHAMSGFVANPMERAEASKVALFGVADYAWNMKAYNPESNFT
DACRFILPEAPEAFRTFCENNCDPGPNGHRYRRDESVRYAAYAEAFLRDFRRHSYNADAS
DRMNQLFAEITAAPAAIETSSNKALIDEIKPWLMQFHLLGKTGQTALSVASAGQGKDRTA
TWQTYLSLTSLLDSMRTIDRTYNQNPYQKGVKTGSRVLTPFVQEIYLQTGRNLLFPDQAD
QAAAQMSKASILTNIEQLKYQPLKESADQIGYNRLNEVLRIEPGQSFGLAWELQKEATSF
SFSLPKSENSGRLFEWSADGKTWTAITSIPADQPRFKLEQIAPEARYIRMRNTTDKQMQI
YLYDFTVTTKEDTSIDPARLMYDKNLESANTLPAGSRIAIDSSKGSSLELYLSGSSHSRV
VVEGTPLKGKTKQVLYSGPAGYIKLDKEALEKVKKVELCNEGPDDVRIHEVI

Enzyme Prediction     

No EC number prediction in MGYG000004281_03390.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH84	148	438	3.4e-111	0.9932203389830508

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07555	NAGidase	2.26e-173	148	437	1	293	beta-N-acetylglucosaminidase. This family has previously been described as a hyaluronidase. However, more recently it has been shown that this family has beta-N-acetylglucosaminidase activity.
pfam02838	Glyco_hydro_20b	9.77e-18	23	141	2	123	Glycosyl hydrolase family 20, domain 2. This domain has a zincin-like fold.
COG3525	Chb	1.57e-08	84	149	198	265	N-acetyl-beta-hexosaminidase [Carbohydrate transport and metabolism].
pfam18344	CBM32	0.001	613	662	14	63	Carbohydrate binding module family 32. This domain is found in GH84C present in Clostridium perfringens. GH84C is a beta-N-acetylglucosaminidase. This domain is a family 32 carbohydrate binding module (CBM) which preferentially recognizes the non-reducing terminus of N-acetyllactosamine.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT47835.1	0.0	1	831	1	830
QRO16908.1	0.0	25	832	29	835
ABR42905.1	0.0	25	832	29	835
QUT54259.1	0.0	25	832	29	835
QUT18960.1	0.0	25	832	29	835

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VVN_A	2.25e-191	2	731	5	736	BtGH84in complex with NH-Butylthiazoline [Bacteroides thetaiotaomicron VPI-5482],2VVN_B BtGH84 in complex with NH-Butylthiazoline [Bacteroides thetaiotaomicron VPI-5482],2VVS_A BtGH84 structure in complex with PUGNAc [Bacteroides thetaiotaomicron VPI-5482],2X0H_A BtGH84 Michaelis complex [Bacteroides thetaiotaomicron VPI-5482],2X0H_B BtGH84 Michaelis complex [Bacteroides thetaiotaomicron VPI-5482],4AIS_A A complex structure of BtGH84 [Bacteroides thetaiotaomicron VPI-5482],4AIS_B A complex structure of BtGH84 [Bacteroides thetaiotaomicron VPI-5482],7OU8_AAA Chain AAA, O-GlcNAcase BT_4395 [Bacteroides thetaiotaomicron VPI-5482],7OU8_BBB Chain BBB, O-GlcNAcase BT_4395 [Bacteroides thetaiotaomicron VPI-5482]
2J4G_A	4.42e-191	25	731	4	714	Bacteroidesthetaiotaomicron GH84 O-GlcNAcase in complex with n-butyl- thiazoline inhibitor [Bacteroides thetaiotaomicron VPI-5482],2J4G_B Bacteroides thetaiotaomicron GH84 O-GlcNAcase in complex with n-butyl- thiazoline inhibitor [Bacteroides thetaiotaomicron VPI-5482]
2J47_A	4.57e-191	25	731	5	715	Bacteroidesthetaiotaomicron GH84 O-GlcNAcase in complex with a imidazole-pugnac hybrid inhibitor [Bacteroides thetaiotaomicron VPI-5482],2W4X_A BtGH84 in complex with STZ [Bacteroides thetaiotaomicron VPI-5482],2W66_A BtGH84 in complex with HQ602 [Bacteroides thetaiotaomicron VPI-5482],2W66_B BtGH84 in complex with HQ602 [Bacteroides thetaiotaomicron VPI-5482],2W67_A BtGH84 in complex with FMA34 [Bacteroides thetaiotaomicron VPI-5482],2W67_B BtGH84 in complex with FMA34 [Bacteroides thetaiotaomicron VPI-5482],2WCA_A BtGH84 in complex with n-butyl pugnac [Bacteroides thetaiotaomicron VPI-5482],2XJ7_A BtGH84 in complex with 6-acetamido-6-deoxy-castanospermine [Bacteroides thetaiotaomicron VPI-5482],2XJ7_B BtGH84 in complex with 6-acetamido-6-deoxy-castanospermine [Bacteroides thetaiotaomicron VPI-5482],2XM1_A BtGH84 in complex with N-acetyl gluconolactam [Bacteroides thetaiotaomicron VPI-5482],2XM1_B BtGH84 in complex with N-acetyl gluconolactam [Bacteroides thetaiotaomicron VPI-5482],2XM2_A BtGH84 in complex with LOGNAc [Bacteroides thetaiotaomicron VPI-5482],2XM2_B BtGH84 in complex with LOGNAc [Bacteroides thetaiotaomicron VPI-5482],4UR9_A Structure of ligand bound glycosylhydrolase [Bacteroides thetaiotaomicron],4UR9_B Structure of ligand bound glycosylhydrolase [Bacteroides thetaiotaomicron],5FKY_A Structure of a hydrolase bound with an inhibitor [Bacteroides thetaiotaomicron],5FKY_B Structure of a hydrolase bound with an inhibitor [Bacteroides thetaiotaomicron],5FL0_A Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron],5FL0_B Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron],5FL1_A Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron],5FL1_B Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron]
2JIW_A	4.57e-191	25	731	5	715	Bacteroidesthetaiotaomicron GH84 O-GlcNAcase in complex with 2- Acetylamino-2-deoxy-1-epivalienamine [Bacteroides thetaiotaomicron VPI-5482],2JIW_B Bacteroides thetaiotaomicron GH84 O-GlcNAcase in complex with 2- Acetylamino-2-deoxy-1-epivalienamine [Bacteroides thetaiotaomicron VPI-5482]
7K41_A	5.03e-191	25	731	8	718	ChainA, O-GlcNAcase BT_4395 [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q89ZI2	1.23e-190	2	731	5	736	O-GlcNAcase BT_4395 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4395 PE=1 SV=1
Q0TR53	1.62e-88	23	441	44	482	O-GlcNAcase NagJ OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=nagJ PE=1 SV=1
Q8XL08	4.26e-88	23	441	44	482	O-GlcNAcase NagJ OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagJ PE=1 SV=1
P26831	3.67e-51	25	734	41	801	Hyaluronoglucosaminidase OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagH PE=1 SV=2
O60502	6.92e-38	149	422	63	348	Protein O-GlcNAcase OS=Homo sapiens OX=9606 GN=OGA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000970	0.997891	0.000450	0.000250	0.000221	0.000198

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004281_03390.