CAZyme Information: MGYG000004287_00024

Basic Information

• Species: Limosilactobacillus caviae
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Limosilactobacillus; Limosilactobacillus caviae
• CAZyme ID: MGYG000004287_00024
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
491	MGYG000004287_1|CGC1	56465.84	6.4389

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004287	2159846	MAG	China	Asia

• Gene Location: Start: 76022; End: 77497 Strand: -

Full Sequence      

MYATDYPKTFPENFLWGGATAASQIEGAWNIDGKKLSGAECIKGAKKGNINSTLDDATLR
SITEAVNSDSEKEYPKRHGNDFYHHYKEDIRLLADMGFKAFRISIAWSRIFPNGDELTPN
EKGLEFYDRVFDEMRKYNIEPVVTLSHYEMPIGLTLKYNGWASRQAISDFTRYTETVFRR
YKDKVKYWMTFNEINTGTTGFHATGALEDGLKTENEKLQLRYQALHYQFVASSLATKQLH
EIIPGAKMGCMLARMQTYPATCNPADVVMAQKVDRLNLFFTDVQVCGEYPEYMNRYFAEH
NITIKMLANDQQILKKYPVDYLSLSYYMSSATTAKEVNDLTAEATGNQHAVRNKYLKTTP
WGWQIDPQGLRIALNTLWDRYRTPLFVVENGMGSYDKISEDGKVHDDYRISYLRAHIEQM
KEAVKDGVQLMGYLTWAPIDLVSFSTSQMSKRYGFVYVDLDDDGNGTLERMPKDSFYWYK
KVIATNGENLD

Enzyme Prediction     

No EC number prediction in MGYG000004287_00024.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	8	487	3.9e-149	0.9906759906759907

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15014	PRK15014	0.0	9	490	5	477	6-phospho-beta-glucosidase BglA; Provisional
COG2723	BglB	0.0	7	491	1	458	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09593	arb	0.0	8	491	4	478	6-phospho-beta-glucosidase; Reviewed
PRK09589	celA	0.0	9	490	3	476	6-phospho-beta-glucosidase; Reviewed
PRK09852	PRK09852	0.0	9	491	3	474	cryptic 6-phospho-beta-glucosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCQ04382.1	3.58e-249	1	490	1	484
QHQ70339.1	5.89e-248	1	490	1	484
QAR36196.1	3.48e-240	1	490	1	486
ANK69133.1	5.13e-240	1	490	1	485
ANK68192.1	5.13e-240	1	490	1	485

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WGD_A	3.26e-192	4	490	2	469	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
2XHY_A	1.91e-171	9	490	7	479	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]
4F66_A	5.25e-169	11	490	8	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	1.49e-168	11	490	8	480	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]
4IPL_A	2.66e-163	10	490	20	485	Thecrystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPL_B The crystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_B The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_E The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40740	1.36e-188	8	490	6	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
Q46130	1.20e-180	6	491	3	472	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1
Q46829	1.05e-170	9	490	7	479	6-phospho-beta-glucosidase BglA OS=Escherichia coli (strain K12) OX=83333 GN=bglA PE=1 SV=2
Q48409	2.90e-169	8	490	2	462	Phospho-cellobiase OS=Klebsiella oxytoca OX=571 GN=casB PE=3 SV=1
P11988	1.44e-168	8	490	2	462	6-phospho-beta-glucosidase BglB OS=Escherichia coli (strain K12) OX=83333 GN=bglB PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000053	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004287_00024.