CAZyme Information: MGYG000004287_00290

Basic Information

• Species: Limosilactobacillus caviae
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Limosilactobacillus; Limosilactobacillus caviae
• CAZyme ID: MGYG000004287_00290
• CAZy Family: GH73
• CAZyme Description: Exo-glucosaminidase LytG

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
198	MGYG000004287_1|CGC4	22481.61	10.0055

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004287	2159846	MAG	China	Asia

• Gene Location: Start: 351840; End: 352436 Strand: +

Full Sequence      

MMKKESKIIIASVLAFLIVLFGIVAVIIHQSPQIQRETHPTDITVNEFVRQIAPAAQQEQ
KKYHIPASITIAQAGLESNWGRSRLANKYNNLFGIKANSDDEKVQMYTTENIRGKNVQVK
QYFTVYNSWADSINAHTLLIVNGTADNHARFRGVQTARNYQQAAYELQKNGYATDPNYAS
KLIYAIKKFNLAQYDNIK

Enzyme Prediction     

No EC number prediction in MGYG000004287_00290.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	53	191	4.8e-38	0.984375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	4.01e-58	2	198	1	191	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
PRK05684	flgJ	1.08e-33	23	189	132	297	flagellar assembly peptidoglycan hydrolase FlgJ.
NF038016	sporang_Gsm	2.38e-33	48	195	163	312	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
TIGR02541	flagell_FlgJ	3.35e-30	47	188	150	292	flagellar rod assembly protein/muramidase FlgJ. The N-terminal region of this protein acts directly in flagellar rod assembly. The C-terminal region is a flagellum-specific muramidase (peptidoglycan hydrolase) required for formation of the outer membrane L ring.
smart00047	LYZ2	6.01e-30	47	195	10	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKT14564.1	2.25e-130	2	198	1	197
AMY14243.1	2.25e-130	2	198	1	197
AGN98435.1	2.25e-130	2	198	1	197
CUU11758.1	2.25e-130	2	198	1	197
QDK47786.1	2.25e-130	2	198	1	197

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FI7_A	7.41e-22	48	195	33	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
5DN5_A	1.13e-17	47	188	5	147	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN4_A	1.58e-17	47	188	5	147	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5T1Q_A	2.74e-17	47	196	62	213	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
3VWO_A	1.88e-14	48	193	4	150	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	6.23e-35	2	197	6	200	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
P39046	3.09e-17	30	195	43	214	Muramidase-2 OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258 / NCTC 12367 / WDCM 00089 / R) OX=768486 GN=EHR_05900 PE=1 SV=1
Q2G222	2.58e-16	47	196	322	473	N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=SAOUHSC_02979 PE=1 SV=1
P75942	2.70e-16	48	188	152	293	Peptidoglycan hydrolase FlgJ OS=Escherichia coli (strain K12) OX=83333 GN=flgJ PE=3 SV=1
P58231	2.70e-16	48	188	152	293	Peptidoglycan hydrolase FlgJ OS=Escherichia coli O157:H7 OX=83334 GN=flgJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.871116	0.117250	0.002067	0.000917	0.000512	0.008152

TMHMM  Annotations     

start	end
7	29