CAZyme Information: MGYG000004287_01881

Basic Information

• Species: Limosilactobacillus caviae
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Limosilactobacillus; Limosilactobacillus caviae
• CAZyme ID: MGYG000004287_01881
• CAZy Family: GT113
• CAZyme Description: Beta-1,6-galactofuranosyltransferase WbbI

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
338	MGYG000004287_12|CGC1	39124.75	9.2861

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004287	2159846	MAG	China	Asia

• Gene Location: Start: 23911; End: 24927 Strand: +

Full Sequence      

MKKVVFTVADYGKGNDAGPKAKRDVDYYLSQSGFEVIHQQLNNKSKLDKIKTAYWVIPRL
FNNVEKFDELFFQYPTYSSYVMKRLINKMRSKSKKLFFIIHDVESLRLFQNDQNYWDGER
ALFNATDGLIVHNHKMKRWLQENGVTVPMVELGIFDYNNPQKINQNSEYDRTICFAGNLA
KSKFLDKISLQAGKLEIFGSYPSEHYLKGVTYHGQMSPDELPKKLTQNFGLVWDGDQLDT
CSGKFGNYMRYNNPHKVSLYLSSGQPVIIWKEAALADFILRNNLGIAVNSLENLDDILEN
ITENQYSEMKMNTIEIAKKLRKGDFIKSAVKKIENITE

Enzyme Prediction     

No EC number prediction in MGYG000004287_01881.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT113	13	334	1.8e-116	0.9782608695652174

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09814	PRK09814	2.92e-107	1	336	1	332	sugar transferase.
cd03794	GT4_WbuB-like	1.23e-11	53	334	85	391	Escherichia coli WbuB and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. WbuB in E. coli is involved in the biosynthesis of the O26 O-antigen. It has been proposed to function as an N-acetyl-L-fucosamine (L-FucNAc) transferase.
cd03817	GT4_UGDG-like	0.002	120	336	142	368	UDP-Glc:1,2-diacylglycerol 3-a-glucosyltransferase and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. UDP-glucose-diacylglycerol glucosyltransferase (EC 2.4.1.337, UGDG; also known as 1,2-diacylglycerol 3-glucosyltransferase) catalyzes the transfer of glucose from UDP-glucose to 1,2-diacylglycerol forming 3-D-glucosyl-1,2-diacylglycerol.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFS34615.1	9.30e-244	1	332	1	332
QFG72966.1	2.81e-139	1	334	1	333
ABQ83618.1	4.75e-119	1	334	1	334
QPB66695.1	4.75e-119	1	334	1	334
BAG25804.1	4.75e-119	1	334	1	334

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4W6Q_A	8.10e-19	62	325	62	317	GlycosyltransferaseC from Streptococcus agalactiae [Streptococcus agalactiae COH1],4W6Q_B Glycosyltransferase C from Streptococcus agalactiae [Streptococcus agalactiae COH1],4W6Q_C Glycosyltransferase C from Streptococcus agalactiae [Streptococcus agalactiae COH1],4W6Q_D Glycosyltransferase C from Streptococcus agalactiae [Streptococcus agalactiae COH1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P37749	3.72e-37	99	333	94	323	Beta-1,6-galactofuranosyltransferase WbbI OS=Escherichia coli (strain K12) OX=83333 GN=wbbI PE=1 SV=1
A0A0H2UR93	1.39e-22	68	327	66	323	Glucosyltransferase 3 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=gtf3 PE=1 SV=1
F8KEJ1	3.53e-21	63	330	66	330	N-acetylglucosaminyltransferase OS=Limosilactobacillus reuteri (strain ATCC 53608) OX=927703 GN=gtf3 PE=1 SV=1
B3XPQ7	8.44e-21	63	330	61	325	Glucosyltransferase 3 OS=Limosilactobacillus reuteri (strain DSM 17509 / CIP 109821 / 100-23) OX=349123 GN=gtf3 PE=3 SV=1
A0A0M3KKZ0	4.34e-18	62	325	60	315	Glucosyltransferase 3 OS=Streptococcus agalactiae serotype III (strain COH1) OX=342616 GN=gtf3 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000063	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004287_01881.