CAZyme Information: MGYG000004287_01886

Basic Information

• Species: Limosilactobacillus caviae
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Limosilactobacillus; Limosilactobacillus caviae
• CAZyme ID: MGYG000004287_01886
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
704	MGYG000004287_12|CGC1	80748.32	6.0046

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004287	2159846	MAG	China	Asia

• Gene Location: Start: 30092; End: 32206 Strand: -

Full Sequence      

MTQKNHIYLASTLTLLSLSTSLYLNSKNVQADTNQVQTEQVNSNDNLSANSASTQSQSAP
SASTFATSSNNVASESTAESTQSLSINSQNSAAPATAYTTVKAAAQTAYDGTPVINIGDA
NYPRVDAVDISGYQASMTPNNFVTLKNLGVKTAIVKVTEGTYYINRYAGQQINYAKNAGL
NVQVYHYAKFGSQGAAINEANYLANEMEALGLDKNTLIYADMEDTTTKYYGVANHLNAFW
NQLNNRGFTNHAVYASTSYDQTYNVSSTVGKNRTWIAQYLYSPSSANLRNQNYGAWQFNA
HGRIPGYNGDLDISIDYQGLVANSGEWSNNNGKWSYSINGNNVTGWQRINNNWYYFNQDG
TAQTGWYQSGAGNWYYFDYTNAWALTGWQYINNNWYYFDYSNAWADKGWQNINNNWYYFD
LTNAWALRGWQTINGNRYYFDPSNVWALKGFQYLDNAWYYFDDSNAWLSHGWRYNGGQWY
YLSPSTGQLESGLQTINGKVYYLQPNHNGYFGAMQTGWFNLNSHWYFFNNGGDAATGWFK
SPAGWWYYFDDNGQARTGWQTINGHQYYFDPTNASNYRGWYRHNNSWYYFDTANAWAVTG
WFKSPGGWWYYFDNDGRARTGWQTINNHKYYFDLTNASAYTNWQKLDGKWYYFDPNNAWT
LTGWQNINGHRYYFDNDGHAVTGYQYIDGKLYHFDQDNAWLLEN

Enzyme Prediction     

No EC number prediction in MGYG000004287_01886.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	128	306	1.6e-33	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06522	GH25_AtlA-like	7.13e-59	125	317	1	192	AtlA is an autolysin found in Gram-positive lactic acid bacteria that degrades bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family includes the AtlA and Aml autolysins from Streptococcus mutans which have a C-terminal glycosyl hydrolase family 25 (GH25) catalytic domain as well as six tandem N-terminal repeats of the GBS (group B Streptococcus) Bsp-like peptidoglycan-binding domain. Other members of this family have one or more C-terminal peptidoglycan-binding domain(s) (SH3 or LysM) in addition to the GH25 domain.
NF033930	pneumo_PspA	2.82e-39	344	610	443	635	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
NF033838	PspC_subgroup_1	1.11e-36	471	658	487	664	pneumococcal surface protein PspC, choline-binding form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site.
NF033838	PspC_subgroup_1	2.17e-35	429	610	487	658	pneumococcal surface protein PspC, choline-binding form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site.
NF033930	pneumo_PspA	2.94e-35	429	652	444	635	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFS34607.1	2.76e-246	1	544	1	544
QFG72957.1	2.93e-138	1	371	1	336
ANK70427.1	7.07e-71	110	345	315	553
ANK62562.1	8.18e-71	110	345	325	563
QEA54166.1	1.45e-65	117	347	308	539

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4KRU_A	1.69e-14	124	331	19	222	X-raystructure of catalytic domain of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101]
4KRT_A	8.51e-14	124	331	19	222	X-raystructure of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101],4KRT_B X-ray structure of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101]
2WAG_A	7.54e-10	124	317	15	207	TheStructure of a family 25 Glycosyl hydrolase from Bacillus anthracis. [Bacillus anthracis str. Ames]
5A6S_A	4.39e-07	145	314	39	199	Crystalstructure of the CTP1L endolysin reveals how its activity is regulated by a secondary translation product [Clostridium phage phiCTP1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P26836	7.82e-11	121	314	5	194	Probable autolytic lysozyme OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=lyc PE=3 SV=2
P34020	2.19e-09	128	322	4	186	Autolytic lysozyme OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) OX=272562 GN=lyc PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001638	0.991127	0.006553	0.000269	0.000198	0.000174

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004287_01886.