CAZyme Information: MGYG000004288_00522

Basic Information

• Species: Faecalicoccus pleomorphus
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelotrichaceae; Faecalicoccus; Faecalicoccus pleomorphus
• CAZyme ID: MGYG000004288_00522
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
238	MGYG000004288_3|CGC2	26894.89	4.7419

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004288	2108901	MAG	China	Asia

• Gene Location: Start: 101117; End: 101833 Strand: -

Full Sequence      

MIKKIGKLIALIFLLAAMSVGCLAGLGYMDYKEAIDQTSIEDKMESIQSHEDYVTLEQLP
ELYRKAVVAVEDHDFYEHQGIDIEAIGRAILNNLKAMSFVEGGSTITQQLAKNEFFTQDK
NFVRKFAEIFMAFDIESKYSKDQILEFYVNSIYFGEGYYGIHAASVGYFDVEPMHLNEAQ
CILLAGIPNAPSVYSLHVNPVLAKQRAKQVLRQMVKYSFLSEAEAQNIAYQLDQMIVG

Enzyme Prediction     

No EC number prediction in MGYG000004288_00522.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	48	215	8.7e-63	0.943502824858757

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00912	Transgly	1.82e-81	52	215	14	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
COG0744	MrcB	9.06e-73	2	226	12	252	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	1.40e-60	1	227	1	243	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
TIGR02071	PBP_1b	1.25e-45	23	226	114	326	penicillin-binding protein 1B. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of a particular bifunctional transglycosylase/transpeptidase in E. coli and other Proteobacteria, designated penicillin-binding protein 1B. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
PRK00056	mtgA	5.63e-45	1	214	4	223	monofunctional biosynthetic peptidoglycan transglycosylase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUO38940.1	1.24e-78	2	225	4	228
BAK43832.1	3.54e-74	2	229	20	244
CBL03605.1	9.75e-74	3	231	16	244
QJU22158.1	1.58e-72	27	238	29	234
QRP41835.1	9.05e-72	27	238	29	234

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OQO_A	5.71e-38	53	221	22	190	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
3NB6_A	2.26e-37	53	221	22	190	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
5ZZK_A	3.02e-36	42	234	48	246	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50]
3HZS_A	4.53e-36	42	233	12	209	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus MW2]
3VMQ_A	4.59e-36	42	234	65	263	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50],3VMQ_B Chain B, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50],3VMR_A Chain A, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50],3VMS_A Chain A, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50],3VMS_B Chain B, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50],3VMT_A Chain A, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50],3VMT_B Chain B, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P38050	2.74e-43	54	225	70	241	Penicillin-binding protein 1F OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpF PE=2 SV=2
P70997	3.65e-40	53	228	76	251	Penicillin-binding protein 2D OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpG PE=2 SV=3
O87579	1.09e-37	1	221	1	238	Penicillin-binding protein 1A OS=Neisseria lactamica OX=486 GN=mrcA PE=3 SV=1
O86088	2.76e-37	48	221	65	238	Penicillin-binding protein 1A OS=Neisseria cinerea OX=483 GN=mrcA PE=3 SV=1
P0A0Z5	9.56e-37	48	221	65	238	Penicillin-binding protein 1A OS=Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491) OX=122587 GN=mrcA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.143270	0.009035	0.847527	0.000031	0.000031	0.000111

TMHMM  Annotations     

start	end
7	29