CAZyme Information: MGYG000004289_00711

Basic Information

• Species: Anaeroglobus micronuciformis
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Megasphaeraceae; Anaeroglobus; Anaeroglobus micronuciformis
• CAZyme ID: MGYG000004289_00711
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
190		22061.19	5.3762

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004289	1684653	MAG	China	Asia

• Gene Location: Start: 144408; End: 144980 Strand: +

Full Sequence      

MRRKSRTGTIVIAVFFVLLSAFYFSGWRQTFMRTLVYPLEYDYIVREYARVNGVRPSLVA
AVVLAESKFKDNASSHRGASGLMQIMPETGEWIAEETGMVGFKPEMLNDVSTNLRMGTWY
LAYLLREYDGNTVLALAAYNAGRGHVDEWMKEYGWDKNFSEIDSIPFSETREYVKVVMQN
EEKYKELYEF

Enzyme Prediction     

No EC number prediction in MGYG000004289_00711.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	54	184	2.8e-30	0.8148148148148148

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	9.32e-80	38	183	1	146	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	7.74e-58	37	187	2	152	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	2.01e-40	56	180	1	109	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	1.51e-35	37	188	135	287	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
pfam01464	SLT	4.08e-29	45	155	1	108	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXL22000.1	5.43e-91	1	190	1	191
AXB81730.1	1.10e-90	1	190	1	191
ALG43012.1	2.84e-86	2	190	3	191
AVO73570.1	5.73e-86	2	190	3	191
AVO26251.1	5.73e-86	2	190	3	191

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	1.16e-24	33	188	404	559	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	1.17e-24	33	188	408	563	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	1.18e-24	33	188	414	569	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	1.19e-24	33	188	418	573	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	1.20e-24	33	188	424	579	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AGC3	2.42e-21	37	185	476	626	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
P0AGC4	2.42e-21	37	185	476	626	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
P39434	3.29e-21	37	185	476	626	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
O31608	1.58e-16	42	177	61	175	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
O64046	9.71e-15	37	183	1418	1543	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.980960	0.008217	0.007947	0.000035	0.000024	0.002834

TMHMM  Annotations     

start	end
7	27