CAZyme Information: MGYG000004289_00833

Basic Information

• Species: Anaeroglobus micronuciformis
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Megasphaeraceae; Anaeroglobus; Anaeroglobus micronuciformis
• CAZyme ID: MGYG000004289_00833
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
521	MGYG000004289_3|CGC1	58616.18	9.3024

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004289	1684653	MAG	China	Asia

• Gene Location: Start: 27965; End: 29530 Strand: -

Full Sequence      

MKFFTAYIHENRYGLGIILLAAIFLLPFLGAFPLIDPDEPVYGQTAREMLAAGDWLSPRI
YGQFWYDKPPLFYWLEMISYSLFGISDYTSRLPSAVMGIATVATVYVQSRAVFNKHIAFR
AALILLTSVGFIYIAKAAVTDMTLVFTLTFSMFAFYRKQYYLAYFGCGLALLAKGPVGYA
FPALIMLLYIAGTRRWSLLKEMKIPQGILLAFLVGLPWYVYMYIVHGTDFTNVFIGYHNI
TRFAAPEHPGQNSIFFFIPIVLGALMPWTGALFQALIRCLRGNGPYRDGLLFCFIWSTFI
FIFFSLSQTQLVTYISPLFPPLSVILGWYTYALKRNGKLPRIWLAVSYIGGVILLACNAI
PLNESALFFATPILWASVLLTLALIIPAAFMHLKRWRSALLSAVSCMFVFMTVAFAGILP
QSAEYISGKAIAEEYISLNHSGPVYIEKFLCPALAFYGNTTGVSWESQNAPDFATLRRET
PDIYVIMQQSTYNKLLRTHTDLSDYNVIATTPGQVILAGRR

Enzyme Prediction     

No EC number prediction in MGYG000004289_00833.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	10	461	1.1e-108	0.8722222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	1.79e-59	17	419	13	429	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	6.06e-40	12	338	6	341	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam13231	PMT_2	3.52e-18	67	218	1	157	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
pfam02366	PMT	1.55e-12	15	223	3	235	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
COG1287	Stt3	1.20e-04	67	417	86	411	Asparagine N-glycosylation enzyme, membrane subunit Stt3 [Posttranslational modification, protein turnover, chaperones].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVO73979.1	8.61e-204	10	517	7	515
CCC72524.1	8.61e-204	10	517	7	515
AVO26796.1	8.61e-204	10	517	7	515
ALG41392.1	1.73e-203	10	517	7	515
AXL21031.1	4.01e-202	7	517	4	515

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	1.86e-43	34	518	54	569	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
C5BDQ8	3.76e-34	20	342	10	345	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Edwardsiella ictaluri (strain 93-146) OX=634503 GN=arnT PE=3 SV=1
O67270	5.25e-34	37	344	28	337	Uncharacterized protein aq_1220 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1220 PE=3 SV=1
B4EUL1	3.61e-32	36	334	33	337	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 1 OS=Proteus mirabilis (strain HI4320) OX=529507 GN=arnT1 PE=3 SV=1
A1JPM4	1.97e-30	14	350	6	368	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) OX=393305 GN=arnT PE=3 SV=1
A4SQX1	4.63e-30	24	360	16	359	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Aeromonas salmonicida (strain A449) OX=382245 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000004	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
13	35
92	114
121	140
160	191
204	226
254	276
289	306
311	333
340	362
372	391
398	420