CAZyme Information: MGYG000004290_00043

Basic Information

• Species: Alistipes sp900549305
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes sp900549305
• CAZyme ID: MGYG000004290_00043
• CAZy Family: CBM32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
330		36924.42	4.825

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004290	3325933	MAG	China	Asia

• Gene Location: Start: 2811; End: 3803 Strand: +

Full Sequence      

MKLTKYLAVLCCGTLFAACENPIQDDLNVDNPENYTRIYTVNAADDTSKNTLSFPLERDT
SFMVYANLSGIRNPGCDVTVKFRVAPELVETYNQKNQSAYPMMLDGSYTIENLETVIPNG
KYISSPIRIAINSKAFDGVGVFLMPVRIESVTPDLTINEALQTAYLRINGYYTENPFPRY
DRTGWSIAGFSTQEAEATSTYPNRGLAVSIIDGENNTYWGTQWRNAKPGPPHWVAVDMGA
PKELHGLTIRGRAEKEGSDVPKSSGNPRIFNIDVSDDNLNWTHAGTFTVENRIENTVYLD
HKATGRYFRIFVTATQADLYQTCIAEVWAF

Enzyme Prediction     

No EC number prediction in MGYG000004290_00043.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM32	193	327	3.5e-20	0.9435483870967742

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam08522	DUF1735	3.31e-19	38	152	5	117	Domain of unknown function (DUF1735). This domain of unknown function is found in a number of bacterial proteins including acylhydrolases. The structure of this domain has a beta-sandwich fold.
pfam00754	F5_F8_type_C	1.66e-14	194	327	1	127	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
cd00057	FA58C	2.35e-08	197	314	16	130	Substituted updates: Jan 31, 2002
smart00231	FA58C	6.87e-04	211	314	28	125	Coagulation factor 5/8 C-terminal domain, discoidin domain. Cell surface-attached carbohydrate-binding domain, present in eukaryotes and assumed to have horizontally transferred to eubacterial genomes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK65129.1	4.72e-239	1	330	1	330
BBL03122.1	7.45e-160	1	330	1	330
BBL15158.1	7.45e-160	1	330	1	330
BBL06727.1	2.72e-155	1	330	1	330
ATL46981.1	6.99e-63	2	330	7	329

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2KD7_A	3.16e-13	182	312	7	128	ChainA, Putative chitobiase [Bacteroides thetaiotaomicron VPI-5482]
3GGL_A	1.87e-12	179	312	14	138	X-RayStructure of the C-terminal domain (277-440) of Putative chitobiase from Bacteroides thetaiotaomicron. Northeast Structural Genomics Consortium Target BtR324A. [Bacteroides thetaiotaomicron],6OE2_A X-Ray Structure of the C-terminal domain (277-440) of Putative chitobiase from Bacteroides thetaiotaomicron. Northeast Structural Genomics Consortium Target BtR324A. Re-refinement of 3GGL with correct metal Mn replacing Zn. New metal confirmed with PIXE analysis of original sample. [Bacteroides thetaiotaomicron]
3F2Z_A	2.58e-11	179	312	4	128	Crystalstructure of the C-terminal domain of a chitobiase (BF3579) from Bacteroides fragilis, Northeast Structural Genomics Consortium Target BfR260B [Bacteroides fragilis NCTC 9343]
1EUT_A	2.37e-07	188	327	465	599	Sialidase,Large 68kd Form, Complexed With Galactose [Micromonospora viridifaciens],1EUU_A Sialidase Or Neuraminidase, Large 68kd Form [Micromonospora viridifaciens]
1W8N_A	2.37e-07	188	327	461	595	Contributionof the Active Site Aspartic Acid to Catalysis in the Bacterial Neuraminidase from Micromonospora viridifaciens. [Micromonospora viridifaciens],1W8O_A Contribution of the Active Site Aspartic Acid to Catalysis in the Bacterial Neuraminidase from Micromonospora viridifaciens [Micromonospora viridifaciens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q02834	1.34e-06	188	327	507	641	Sialidase OS=Micromonospora viridifaciens OX=1881 GN=nedA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000070	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004290_00043.