CAZyme Information: MGYG000004290_01145

Basic Information

• Species: Alistipes sp900549305
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes sp900549305
• CAZyme ID: MGYG000004290_01145
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
175		19886.28	10.3426

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004290	3325933	MAG	China	Asia

• Gene Location: Start: 33; End: 560 Strand: +

Full Sequence      

MPEDTLLDDFVCSMLIAADGYKIAYCKEAYALETPSADMGEEGKRKRRIAAGGLQSVWRL
RKLLNPFRYGVLWFQYVSHRVLRWTITPVALAALIPLNVALLWSGHPTLYAVLLALQAAF
YLTAFAGWLRERRGHRGGMLSVPYYFLFMNLNVFRGAGYLATHRGRGAWEKARRA

Enzyme Prediction     

No EC number prediction in MGYG000004290_01145.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06439	CESA_like_1	4.20e-16	1	56	196	251	CESA_like_1 is a member of the cellulose synthase (CESA) superfamily. This is a subfamily of cellulose synthase (CESA) superfamily. CESA superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members of the superfamily include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins.
COG1215	BcsA	7.70e-05	2	148	233	390	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBL09123.1	1.65e-104	3	175	218	390
BBL11915.1	1.65e-104	3	175	218	390
BBL01213.1	1.65e-104	3	175	218	390
AFL77658.1	9.42e-104	1	175	216	390
QJE27381.1	9.12e-74	1	174	220	392

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
81	103
107	129