CAZyme Information: MGYG000004291_00603

Basic Information

• Species: Alloprevotella tannerae
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Alloprevotella; Alloprevotella tannerae
• CAZyme ID: MGYG000004291_00603
• CAZy Family: GT11
• CAZyme Description: O-antigen biosynthesis glycosyltransferase WbnK

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
214		25657.3	7.9936

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004291	1823678	MAG	China	Asia

• Gene Location: Start: 57512; End: 58156 Strand: -

Full Sequence      

MISWWFKKFRSNGLLFQQYSDNASDMPIPSNKNIVCYGKYENPKYFDAIRPILLKEFTPK
YPERPENESLYKAIRNTNSVCIAVRRGDFLEDNFKNQFYVCNRDYFFKAIAEARKRIENP
TFIFFSNDIEWVKQNIILEEPCYYESGEDPVWETIRLMYNCKHFIMSNSTFSWWAQYLSR
NEKKVVIAPDRWSNNPEIEGHLLLDSFIKIPISK

Enzyme Prediction     

No EC number prediction in MGYG000004291_00603.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT11	17	197	2e-60	0.6521739130434783

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd11301	Fut1_Fut2_like	1.18e-47	28	198	83	261	Alpha-1,2-fucosyltransferase. Alpha-1,2-fucosyltransferases (Fut1, Fut2) catalyze the transfer of alpha-L-fucose to the terminal beta-D-galactose residue of glycoconjugates via an alpha-1,2-linkage, generating carbohydrate structures that exhibit H-antigenicity for blood-group carbohydrates. These structures also act as ligands for morphogenesis, the adhesion of microbes, and metastasizing cancer cells. Fut1 is responsible for producing the H antigen on red blood cells. Fut2 is expressed in epithelia of secretory tissues, and individuals termed "secretors" have at least one functional copy of the gene; they secrete H antigen which is further processed into A and/or B antigens depending on the ABO genotype. O-fucosyltransferase-like proteins are GDP-fucose dependent enzymes with similarities to the family 1 glycosyltransferases (GT1). They are soluble ER proteins that may be proteolytically cleaved from a membrane-associated preprotein, and are involved in the O-fucosylation of protein substrates, the core fucosylation of growth factor receptors, and other processes.
pfam01531	Glyco_transf_11	2.12e-34	28	196	118	282	Glycosyl transferase family 11. This family contains several fucosyl transferase enzymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUB53170.1	1.73e-104	5	212	100	307
QUB64810.1	3.54e-101	5	212	100	307
BBA28972.1	2.47e-79	5	211	97	305
QUB75005.1	2.84e-78	5	211	97	305
QBQ85370.1	7.01e-58	38	210	140	312

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q58YV9	4.90e-16	70	210	158	302	O-antigen biosynthesis glycosyltransferase WbnK OS=Escherichia coli OX=562 GN=wbnK PE=1 SV=1
Q866D6	3.07e-11	45	179	173	318	Galactoside alpha-(1,2)-fucosyltransferase 1 OS=Leontopithecus chrysomelas OX=57374 GN=FUT1 PE=3 SV=1
Q9JL27	3.93e-11	45	179	160	303	Galactoside alpha-(1,2)-fucosyltransferase 2 OS=Mus musculus OX=10090 GN=Fut2 PE=1 SV=1
Q866E8	4.18e-11	45	179	174	319	Galactoside alpha-(1,2)-fucosyltransferase 1 OS=Sapajus apella OX=9515 GN=FUT1 PE=3 SV=1
Q866F0	4.18e-11	45	179	174	319	Galactoside alpha-(1,2)-fucosyltransferase 1 OS=Saimiri boliviensis boliviensis OX=39432 GN=FUT1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004291_00603.