CAZyme Information: MGYG000004292_01271

Basic Information

• Species: UMGS1474 sp900552115
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UMGS1474; UMGS1474 sp900552115
• CAZyme ID: MGYG000004292_01271
• CAZy Family: GH99
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
601		66831.02	5.868

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004292	2231746	MAG	China	Asia

• Gene Location: Start: 35; End: 1840 Strand: -

Full Sequence      

MNTFAVKPSPQTEQNHLLGKTFAGYQAWFHASEDLDHGWGHWSHKTAPETGHAHIEMFPD
LTEYPSSVLYPSRFETYPDGRTVRFYQAHDPAAIDVHFRWMREYGIDGVGVQRFYGATRA
ESQPEPTHLTAVRDAAERHGRLFYIMYDTSGCGRDGAQAIDRFKADLLHNVEEKNLIASH
SYAHADGKPVICIWGLAGTEPGRYPAADDALELVRWLKERGYFVIGGLPDNRWTDVTDEY
AAVYAMLDMASPWTPGRFRQETLDQWIGRHLEKDLAYCRAHGIRYQPVMFAGFAWSNFGT
GGNPDATPRDAGRFLWEQAKRYARAGVDAGYVAMFDEYDEGTAIAKAASDSFDLPQGRQY
FQTLSTDGTWLSSDFYLRLAGAVTKLLRRELPHNEAVPVAHSEGPVYWRNGFEQRPATMT
LARGQARGTVLRNVDVCDAHAKVLYQEAVQLETAAVITGQRGDVCYTGSCGFAFSGIAMT
DGLCEVRYRLAKTEIPVVKGLTLSYRMRPVSEAGRMVGVDLLFDDGSFLSDLCPAVLQEK
RDPATGHVSSGIPLHDWQTVVQPLPEATVGKTVQAVTVVYSAGGEARFAAYLDDILLALD
V

Enzyme Prediction     

No EC number prediction in MGYG000004292_01271.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH99	24	360	9.3e-16	0.9161676646706587

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd11576	GH99_GH71_like_2	1.95e-142	17	390	3	378	Uncharacterized glycoside hydrolase family 99-like domain. This family of putative glycoside hydrolases resembles glycosyl hydrolase families 71 and 99 (following the CAZY nomenclature) and may share a similar catalytic site and mechanism. The domain may co-occur with other domains involved in the binding/processing of glycans.
cd11573	GH99_GH71_like	1.73e-27	85	377	4	276	Glycoside hydrolase families 71, 99, and related domains. This superfamily of glycoside hydrolases contains families GH71 and GH99 (following the CAZY nomenclature), as well as other members with undefined function and specificity.
cd11574	GH99	2.29e-09	25	140	5	112	Glycoside hydrolase family 99, an endo-alpha-1,2-mannosidase. This family of glycoside hydrolases 99 (following the CAZY nomenclature) includes endo-alpha-1,2-mannosidase (EC 3.2.1.130), which is an important membrane-associated eukaryotic enzyme involved in the maturation of N-linked glycans. Specifically, it cleaves mannoside linkages internal to N-linked glycan chains by hydrolyzing an alpha-1,2-mannosidic bond between a glucose-substituted mannose and the remainder of the chain. The biological function and significance of the soluble bacterial orthologs, which may have obtained the genes via horizontal transfer, is not clear.
cd11575	GH99_GH71_like_3	5.22e-04	20	344	8	307	Uncharacterized glycoside hydrolase family 99-like domain. This family of putative glycoside hydrolases resembles glycosyl hydrolase families 71 and 99 (following the CAZY nomenclature) and may share a similar catalytic site and mechanism.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOS78953.1	5.33e-87	17	401	173	562
QLG40767.1	1.57e-85	4	401	160	562
ASS66155.1	2.35e-84	17	401	173	562
ADO73503.1	3.00e-84	17	401	328	717
QRO00804.1	3.13e-84	17	401	330	719

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999870	0.000176	0.000002	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004292_01271.