CAZyme Information: MGYG000004295_02326

Basic Information

• Species: Providencia rettgeri
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Providencia; Providencia rettgeri
• CAZyme ID: MGYG000004295_02326
• CAZy Family: AA10
• CAZyme Description: GlcNAc-binding protein A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
192	MGYG000004295_57|CGC1	22031.4	9.6755

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004295	4142275	MAG	Israel	Asia

• Gene Location: Start: 15793; End: 16371 Strand: -

Full Sequence      

MKSFSIKSFLFAPLLFCCSFVVWSHGYVKSPESRSYYCKLGGNKQCGPVQYEPQSIEGKQ
GFPKYGPADGKIASAANALFSPLDIQTTVRWQRAIINSPNVRFKWRITAKHKTTKWEYFI
TKPDWQPNSPLSRKQFILTPFCKFERVEIPGESVEHNCVLPKNQKGYHVILAIWTINDTV
NAFYQVIDAEIN

Enzyme Prediction     

No EC number prediction in MGYG000004295_02326.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA10	25	189	2e-51	0.9887640449438202

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK13211	PRK13211	4.97e-88	1	192	1	194	N-acetylglucosamine-binding protein GbpA.
cd21177	LPMO_AA10	5.87e-69	25	188	1	178	lytic polysaccharide monooxygenase (LPMO) auxiliary activity family 10 (AA10). AA10 proteins are copper-dependent lytic polysaccharide monooxygenases (LPMOs), which may act on chitin or cellulose. The family used to be called CBM33. Activities in this family include lytic cellulose monooxygenase (C1-hydroxylating) (EC 1.14.99.54), lytic cellulose monooxygenase (C4-dehydrogenating) (EC 1.14.99.56), lytic chitin monooxygenase (EC 1.14.99.53), and lytic xylan monooxygenase/xylan oxidase (glycosidic bond-cleaving) (EC 1.14.99.-). Also included are viral chitin-binding glycoproteins such as fusolin and spheroidin-like proteins.
COG3397	COG3397	1.06e-65	1	192	1	208	Predicted carbohydrate-binding protein, contains CBM5 and CBM33 domains [General function prediction only].
pfam03067	LPMO_10	2.24e-53	25	188	1	185	Lytic polysaccharide mono-oxygenase, cellulose-degrading. This domain is found associated with a wide variety of cellulose binding domains. This is a family of two very closely related proteins that together act as both a C1- and a C4-oxidising lytic polysaccharide mono-oxygenase, degrading cellulose. This domain is also found in baculoviral spheroidins and spindolins, protein of unknown function.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWS51697.1	2.38e-145	1	192	1	192
QZY62658.1	2.38e-145	1	192	1	192
QIF57910.1	1.38e-144	1	192	1	192
QIF61950.1	1.38e-144	1	192	1	192
BBU95908.1	1.63e-118	1	192	1	192

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2BEM_A	6.24e-66	25	192	1	169	Crystalstructure of the Serratia marcescens chitin-binding protein CBP21 [Serratia marcescens],2BEM_B Crystal structure of the Serratia marcescens chitin-binding protein CBP21 [Serratia marcescens],2BEM_C Crystal structure of the Serratia marcescens chitin-binding protein CBP21 [Serratia marcescens],2LHS_A Structure of the chitin binding protein 21 (CBP21) [Serratia marcescens]
2BEN_A	1.45e-64	25	192	1	169	Crystalstructure of the Serratia marcescens chitin-binding protein CBP21 Y54A mutant. [Serratia marcescens],2BEN_B Crystal structure of the Serratia marcescens chitin-binding protein CBP21 Y54A mutant. [Serratia marcescens]
6T5Z_A	1.91e-63	25	192	1	172	Crystalstructure of an AA10 LPMO from Photorhabdus luminescens [Photorhabdus laumondii subsp. laumondii TTO1],6T5Z_B Crystal structure of an AA10 LPMO from Photorhabdus luminescens [Photorhabdus laumondii subsp. laumondii TTO1],6T5Z_C Crystal structure of an AA10 LPMO from Photorhabdus luminescens [Photorhabdus laumondii subsp. laumondii TTO1]
5WSZ_A	3.78e-62	25	191	1	166	Crystalstructure of a lytic polysaccharide monooxygenase,BtLPMO10A, from Bacillus thuringiensis [Bacillus thuringiensis serovar kurstaki],5WSZ_B Crystal structure of a lytic polysaccharide monooxygenase,BtLPMO10A, from Bacillus thuringiensis [Bacillus thuringiensis serovar kurstaki],5WSZ_C Crystal structure of a lytic polysaccharide monooxygenase,BtLPMO10A, from Bacillus thuringiensis [Bacillus thuringiensis serovar kurstaki],5WSZ_D Crystal structure of a lytic polysaccharide monooxygenase,BtLPMO10A, from Bacillus thuringiensis [Bacillus thuringiensis serovar kurstaki]
2XWX_A	5.60e-50	25	190	1	177	Vibriocholerae colonization factor GbpA crystal structure [Vibrio cholerae],2XWX_B Vibrio cholerae colonization factor GbpA crystal structure [Vibrio cholerae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8EHY2	5.24e-60	24	190	27	194	GlcNAc-binding protein A OS=Shewanella oneidensis (strain MR-1) OX=211586 GN=gbpA PE=3 SV=2
Q8D7V4	1.35e-49	10	190	9	199	GlcNAc-binding protein A OS=Vibrio vulnificus (strain CMCP6) OX=216895 GN=gbpA PE=3 SV=1
Q7MEW9	1.90e-49	10	190	9	199	GlcNAc-binding protein A OS=Vibrio vulnificus (strain YJ016) OX=196600 GN=gbpA PE=3 SV=1
Q87FT0	1.97e-49	1	190	1	200	GlcNAc-binding protein A OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=gbpA PE=3 SV=1
A5F0H4	7.32e-49	21	190	20	200	GlcNAc-binding protein A OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) OX=345073 GN=gbpA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000211	0.999251	0.000163	0.000135	0.000122	0.000118

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004295_02326.