CAZyme Information: MGYG000004296_00963

Basic Information

• Species: Ruminococcus_A faecicola
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Ruminococcus_A; Ruminococcus_A faecicola
• CAZyme ID: MGYG000004296_00963
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
816	MGYG000004296_22|CGC1	94913.96	6.0533

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004296	2845901	MAG	Israel	Asia

• Gene Location: Start: 15975; End: 18425 Strand: +

Full Sequence      

MQREVFVVEKERFDLADDRIYHLQGTWPKEHTAAAELDGKPLEVNLKQQERISALERFQD
LDLVDAVRIQMEIRFPEKLEQYKKLVVYAVQGGKKDVWFSIPVKQLIRRQGMPQYFIESS
EVDRKLGICRVRGWAAYMEPLKVYLENSRGNRIPCEIQHLKRVDVQNQYPEAEVEEKCGF
FFELHYQQLKEFYIVFEAGSVRVRRQIHLQPVQLAAEKMNEYCKKGSRYLKLHGPVALAE
KVVGKVKNKNKAAVIYQKWLPKHLPSKAELERQRQEHFSWEPTFSVVVPLYKTPEKYLRA
LVESLQAQTYGKWELCLSDGSGADSPIRELLKQLQKEEGRIRVIDHQEQLQISENTNAAI
EAATGEFVVFADHDDELTAHALYECVKALNEKPETEVLYSDEDKMTMDGHKFFQPHFKPD
YNVDLLCTVNYICHLFVAKKTLIDEVGMLRREFDGAQDYDFIFRCVEHAGAEKIHHIPKI
LYHWRCHEDSTSENPESKLYAFDAGQRAVQAHYDRIGVKVEVSKGEFLGLYRTKFLRDYD
PLISIIIPNKDHIDDLKRCIDSIEEKSTYKNYEYIIVENNSEEKETFAYYQQLEAVNSKV
HVVYYKGHFNYSAINNFGVQYAKGEYFLLLNNDTEIINEDCLEELLGYCTREDVGAVGAR
LYYEDDTIQHAGVVIGFGGIAGHCFVQQKRGFTGYCHRIICAQDYSAVTAACMMVKRKAF
EEVGGLSEELQVAFNDIDFCMKLRQAGYLIVYNPYAELYHYESKSRGLEDTPEKVARFNQ
EIATFEKRWPEILKNGDPFYNPNLTLDSQDFSLKRL

Enzyme Prediction     

No EC number prediction in MGYG000004296_00963.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	285	397	4.5e-22	0.6529411764705882
GT2	544	724	1e-20	0.9941176470588236

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04184	GT2_RfbC_Mx_like	1.74e-97	282	486	1	202	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd04186	GT_2_like_c	1.36e-43	545	762	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	1.59e-29	541	767	3	226	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
pfam00535	Glycos_transf_2	2.16e-19	285	400	1	114	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
pfam00535	Glycos_transf_2	5.85e-19	544	720	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL21587.1	0.0	1	816	1	815
QCU01344.1	0.0	1	816	1	815
QJU15224.1	0.0	1	816	1	816
ASU27525.1	0.0	1	816	1	816
ANU74720.1	0.0	1	816	1	816

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HEA_A	2.27e-07	285	389	8	109	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	6.33e-142	282	813	366	897	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	1.02e-90	256	815	293	842	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
P71057	3.08e-11	282	500	4	227	Putative glycosyltransferase EpsH OS=Bacillus subtilis (strain 168) OX=224308 GN=epsH PE=2 SV=1
Q58457	1.06e-10	281	502	7	231	Uncharacterized glycosyltransferase MJ1057 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1057 PE=3 SV=2
Q0P9C6	1.81e-07	282	391	2	110	GalNAc(5)-diNAcBac-PP-undecaprenol beta-1,3-glucosyltransferase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) OX=192222 GN=pglI PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004296_00963.