CAZyme Information: MGYG000004298_00241

Basic Information

• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; RF32; CAG-977; UBA11549
• CAZyme ID: MGYG000004298_00241
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
391		42966.93	9.1334

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004298	2105780	MAG	Israel	Asia

• Gene Location: Start: 44490; End: 45665 Strand: -

Full Sequence      

MTRDNELFVYLIAGEPSGDLLASRLMRALREKTNGKVRFAGIGGETMIENGFESLFDSSE
LAVMGLAEVIPSIPRILKRIRQTVDDIATKKPDVVVTVDSWSFSARVNQKLKARHTGIPQ
IHYVAPQVWAWKKGRAKTCGRYIDRLMALLPHEAKYFEPYGLKADFVGHPVVEGGASKGN
GKAFRKKIDVADNVKLLCVLPGSRRSETKYLLPVFKETVSVLAKKYPDMHIVIPTVVTVE
RTVRAAVADWVLPVHVVTGEANRYDAFAACDAALAASGTVALELAMAKVPYTIAYKMNPL
SSFLARKLVSGRFANLVNILPDREIVKEYLLEDCTAGNLAAEIEKLLDDQAYRETEVTQA
FDVLKTLGADDPVPPSRKAAEVILDVAGVKV

Enzyme Prediction     

No EC number prediction in MGYG000004298_00241.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	9	364	1.6e-118	0.9830508474576272

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0763	LpxB	4.98e-132	9	387	4	379	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
PRK00025	lpxB	9.16e-132	9	388	4	376	lipid-A-disaccharide synthase; Reviewed
pfam02684	LpxB	4.51e-96	9	361	1	355	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	5.29e-78	11	357	10	357	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	8.52e-49	13	339	8	309	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAE51288.1	2.33e-133	7	385	1	379
ARJ65449.1	5.14e-131	7	385	6	384
CUW40282.1	1.68e-129	7	385	6	384
QIM10250.1	2.09e-128	4	386	2	383
ACI98608.1	5.42e-127	7	386	4	382

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	3.76e-62	1	387	1	381	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	5.29e-62	1	387	1	381	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2W4D7	4.65e-134	7	385	1	379	Lipid-A-disaccharide synthase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) OX=342108 GN=lpxB PE=3 SV=1
B6IST7	1.08e-127	7	386	4	382	Lipid-A-disaccharide synthase OS=Rhodospirillum centenum (strain ATCC 51521 / SW) OX=414684 GN=lpxB PE=3 SV=1
Q5FUA3	8.19e-96	9	383	31	402	Lipid-A-disaccharide synthase OS=Gluconobacter oxydans (strain 621H) OX=290633 GN=lpxB PE=3 SV=1
Q0BS63	7.53e-94	9	388	6	392	Lipid-A-disaccharide synthase OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) OX=391165 GN=lpxB PE=3 SV=1
Q3SRI5	8.40e-85	9	385	13	387	Lipid-A-disaccharide synthase OS=Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255) OX=323098 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000075	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004298_00241.