CAZyme Information: MGYG000004300_00299

Basic Information

• Species: UBA1259 sp003523255
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; Borkfalkiaceae; UBA1259; UBA1259 sp003523255
• CAZyme ID: MGYG000004300_00299
• CAZy Family: GH109
• CAZyme Description: Alpha-N-acetylgalactosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
412		46239.83	5.2525

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004300	1359220	MAG	Israel	Asia

• Gene Location: Start: 1935; End: 3173 Strand: +

Full Sequence      

MDKLKLGIVGLGQRGAGMLKTFLLFNNVEVVAVCDGYSDRVEAAKKVVNEKSGVTPAGYT
LYDDMLKDENVKAVYVASSWDEHIGMAIKSMRAGKITGMEVGGAYELEECWELVKAYEET
KTPFMFLENCCYDRFELLCTTLARRGDFGEIVHCHGAYSHDLRDEILGGVVNRHYRLDNY
KKRNCENYPTHEIGPIAKILDINRGNKFMYLSSFSSKAAGLVAFENDKRNPDPNQVGAKF
AQGDIVTTTIKCAGGETITLTLDTTLPKYYSREFTVRGTKGLANQEADMIMIEGDTDFHS
SWIPHEMVEKELKSAERYEKYLPDIWQNISEEESKAGHGGMDYLMLKQFVKCAVSGEEMP
IDVYDAAAWMCITALSEQSIAMGSMPVPVPDFTKGKWIKRERKDVTPLKTEC

Enzyme Prediction     

No EC number prediction in MGYG000004300_00299.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	1	399	5.5e-142	0.9899749373433584

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	5.57e-18	1	161	1	158	Predicted dehydrogenase [General function prediction only].
pfam01408	GFO_IDH_MocA	1.49e-08	4	125	1	117	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUO31207.1	8.64e-146	1	400	1	398
ALS29040.1	4.76e-144	2	401	3	399
AVM42018.1	5.67e-143	1	398	1	397
QTH43530.1	1.93e-142	2	400	3	398
QBE96673.1	1.62e-140	1	398	1	390

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2IXA_A	1.00e-92	3	397	20	431	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]
6T2B_A	6.68e-69	1	397	40	438	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]
3E18_A	1.47e-06	1	157	3	156	CRYSTALSTRUCTURE OF NAD-BINDING PROTEIN FROM Listeria innocua [Listeria innocua],3E18_B CRYSTAL STRUCTURE OF NAD-BINDING PROTEIN FROM Listeria innocua [Listeria innocua]
3EVN_A	7.39e-06	1	152	3	149	CRYSTALSTRUCTURE OF putative oxidoreductase from Streptococcus agalactiae 2603V/r [Streptococcus agalactiae serogroup V]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A4Q8F7	5.50e-92	3	397	20	431	Alpha-N-acetylgalactosaminidase OS=Elizabethkingia meningoseptica OX=238 GN=nagA PE=1 SV=1
A4Q8G1	1.99e-82	4	401	53	463	Alpha-N-acetylgalactosaminidase OS=Tannerella forsythia OX=28112 GN=nagA PE=3 SV=1
A6LB54	1.48e-81	3	401	49	461	Glycosyl hydrolase family 109 protein OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152) OX=435591 GN=BDI_1155 PE=3 SV=1
B2FLK4	3.29e-80	3	401	33	445	Glycosyl hydrolase family 109 protein OS=Stenotrophomonas maltophilia (strain K279a) OX=522373 GN=Smlt4431 PE=3 SV=1
A1RI61	2.31e-78	1	397	52	448	Glycosyl hydrolase family 109 protein OS=Shewanella sp. (strain W3-18-1) OX=351745 GN=Sputw3181_1518 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000086	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004300_00299.