CAZyme Information: MGYG000004300_00852

Basic Information

• Species: UBA1259 sp003523255
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; Borkfalkiaceae; UBA1259; UBA1259 sp003523255
• CAZyme ID: MGYG000004300_00852
• CAZy Family: GH4
• CAZyme Description: Alpha-galacturonidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
462		51809.98	5.2711

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004300	1359220	MAG	Israel	Asia

• Gene Location: Start: 2981; End: 4369 Strand: +

Full Sequence      

MRDIKNLKICFIGGGSRGWARNFMNDMAKEKDLSATVYIYDIDSHAAECNAKIGNALCER
EDVVGTTKYVVESDMGKALDGAEFVIISILPGTFDEMESDVHAPEKYGIYQSVGDSTGPG
GIVRALRTLPMFREFALGIKDHCPNAWVINFTNPMSMCVNAMYRVFPEIKAFGCCHEVFG
TKNLLAQIYNEKYGVMPTRDEISANVSGVNHFTWFTSASCKGEDLFPLYAEFVKNHPDGV
KNGEDKNWANSMFACSHQVKFDLFKRFGAIACAGDRHLAEFCPGGWYLSSPERVKEMGFG
LTTVAWRKKDLEERIKRQEETAAGKKFELYECGEESVRQIRALLGIEPFVTNVNTPNRGQ
CPDLPLGAVVETDAFFSSDSVRPLYAGKLPMPVNALVRRIAENQESVVTAALNGDYELAF
EAFVNDPNCEITIDNARKLFDEMLFNTKKYLPYYDEYVKRSK

Enzyme Prediction     

No EC number prediction in MGYG000004300_00852.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH4	8	188	5.7e-56	0.9888268156424581

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd05297	GH4_alpha_glucosidase_galactosidase	9.31e-151	7	444	1	423	Glycoside Hydrolases Family 4; Alpha-glucosidases and alpha-galactosidases. linked to 3D####ucture
COG1486	CelF	7.23e-106	5	452	2	437	Alpha-galactosidase/6-phospho-beta-glucosidase, family 4 of glycosyl hydrolase [Carbohydrate transport and metabolism].
PRK15076	PRK15076	1.43e-76	8	454	3	430	alpha-galactosidase; Provisional
pfam02056	Glyco_hydro_4	2.45e-54	8	191	1	183	Family 4 glycosyl hydrolase.
cd05197	GH4_glycoside_hydrolases	2.69e-50	7	444	1	423	Glycoside Hydrases Family 4. Glycoside hydrolases cleave glycosidic bonds to release smaller sugars from oligo- or polysaccharides. Some bacteria simultaneously translocate and phosphorylate disaccharides via the phosphoenolpyruvate-dependent phosphotransferase system (PEP-PTS). After translocation, these phospho-disaccharides may be hydrolyzed by GH4 glycoside hydrolases. Other organisms (such as archaea and Thermotoga maritima) lack the PEP-PTS system, but have several enzymes normally associated with the PEP-PTS operon. GH4 family members include 6-phospho-beta-glucosidases, 6-phospho-alpha-glucosidases, alpha-glucosidases/alpha-glucuronidases (only from Thermotoga), and alpha-galactosidases. They require two cofactors, NAD+ and a divalent metal (Mn2+, Ni2+, Mg2+), for activity. Some also require reducing conditions. GH4 glycoside hydrolases are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SNX53414.1	5.05e-186	4	451	8	458
AFK85236.1	4.40e-185	4	451	8	458
ADL69889.1	3.58e-184	4	451	8	458
QEH67112.1	1.37e-178	4	452	8	459
ADZ85649.1	1.37e-178	4	451	8	458

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FEF_A	3.99e-138	3	444	2	436	Crystalstructure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_B Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_C Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_D Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis]
5C3M_A	1.96e-35	5	462	3	442	Crystalstructure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_B Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_C Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_D Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
1S6Y_A	1.38e-34	5	461	6	447	2.3Acrystal structure of phospho-beta-glucosidase [Geobacillus stearothermophilus]
7BR4_A	1.35e-18	7	456	13	473	ChainA, Alpha-glucosidase, putative [Thermotoga maritima MSB8]
1U8X_X	2.36e-17	68	456	89	466	CrystalStructure Of Glva From Bacillus Subtilis, A Metal-requiring, Nad-dependent 6-phospho-alpha-glucosidase [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
I3VRU1	8.81e-186	4	451	8	458	Alpha-galacturonidase OS=Thermoanaerobacterium saccharolyticum (strain DSM 8691 / JW/SL-YS485) OX=1094508 GN=Tsac_0200 PE=1 SV=1
D3T426	3.46e-160	4	451	8	450	Alpha-galacturonidase OS=Thermoanaerobacter italicus (strain DSM 9252 / Ab9) OX=580331 GN=Thit_1733 PE=1 SV=1
A9KTB9	3.80e-160	4	452	8	461	Alpha-galacturonidase OS=Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) OX=357809 GN=Cphy_3396 PE=1 SV=1
P39130	1.12e-141	4	444	7	440	Alpha-galacturonidase OS=Bacillus subtilis (strain 168) OX=224308 GN=lplD PE=1 SV=2
O34645	4.12e-47	8	454	3	431	Alpha-galactosidase OS=Bacillus subtilis (strain 168) OX=224308 GN=melA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004300_00852.