CAZyme Information: MGYG000004304_00266

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; UBA1394
• CAZyme ID: MGYG000004304_00266
• CAZy Family: GH24
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
639	MGYG000004304_21|CGC1	72338.94	4.2166

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004304	1366914	MAG	Israel	Asia

• Gene Location: Start: 5839; End: 7758 Strand: +

Full Sequence      

MKLRFKKILCILVSAAFCVHFYPVYAAEDMRVSQECIELIKAAEGFSRYKYWDYSQWTIG
YGTGVSEDEYPDGITEAEAEELLYNAVVRYEGYVNNFADRYDVSLKQNQFDALVSLTYNM
GNIWSAYDTFDLKTYVINGSENYSFLDIAKGFGEWRVAGGSVIQGLVTRRQEETKLFLSD
REDYSGEVWRVNSEEGTNLRSEPDINSERIGFMKMNTIFYVTEKKTTGDGYLWGKVSYEG
EECWCVLDFSKYIDGGPIECIEDGDEVSGEKWIITSEDGVRLRSGPGLNYENLAIIPKDK
EIIVTSTAEADGYLWGKTKFAGSEGWCALDFAERKDNQDAELPGRTLESIYISSMPNKLT
YTEGEMFDPEGICVKAVYSDGSEEAIPDFTLDGFESAPGTHTINVTYMNKTASFEVEVIQ
KQLTGIEIAKLPDKTVYSQGEQLDISGIKVNALFNNGTAEEILDFSVSGYNHFIGEKKIV
IEYQGFTADFNVEVIEKKLTAVEITKLPHKLEYFKGEQFSTKGMIVYAYYDNHSKNAVTD
YTVSGFDPQKVGDQVIRISYNGFIQTFIVSVKEQKERPLIGDLDGDGKRTIFDLILLNQY
AENGYNDLEYDKFCAADINGDKLINDFDIEILTYMISQE

Enzyme Prediction     

No EC number prediction in MGYG000004304_00266.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH24	32	173	2.4e-29	0.9927007299270073

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00737	lyz_endolysin_autolysin	9.71e-35	36	178	1	136	endolysin and autolysin. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
COG3772	RrrD	1.94e-20	30	180	5	150	Phage-related lysozyme (muramidase), GH24 family [Cell wall/membrane/envelope biogenesis].
cd16901	lyz_P1	1.41e-15	31	176	1	138	P1 lysozyme Lyz-like proteins. Enterobacteria phage P1 lysozyme Lyz is secreted to the Escherichia coli periplasm where it is membrane bound and inactive. Activation involves the release from the membrane, an intramolecular thiol-disulfide isomerization and extensive structural rearrangement of the N-terminal region. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
cd14256	Dockerin_I	2.73e-09	580	636	1	56	Type I dockerin repeat domain. Bacterial cohesin domains bind to a complementary protein domain named dockerin, and this interaction is required for the formation of the cellulosome, a cellulose-degrading complex. The cellulosome consists of scaffoldin, a noncatalytic scaffolding polypeptide, that comprises repeating cohesion modules and a single carbohydrate-binding module (CBM). Specific calcium-dependent interactions between cohesins and dockerins appear to be essential for cellulosome assembly. This subfamily represents type I dockerins, which are responsible for anchoring a variety of enzymatic domains to the complex.
cd16900	endolysin_R21-like	9.51e-08	39	178	11	142	endolysin R21-like proteins. Unlike T4 E phage lysozyme, the endolysin R21 from Enterobacteria phage P21 has an N-terminal SAR (signal-arrest-release) domain that anchors the endolysin to the membrane in an inactive form, which act to prevent premature lysis of the infected bacterium. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACR76485.1	3.30e-35	25	240	71	288
ADQ05619.1	1.83e-27	345	575	249	498
ADD02972.1	1.18e-24	345	632	230	520
QUW24060.1	1.96e-24	286	572	215	518
BAC87940.1	2.40e-24	288	576	248	555

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ET6_A	1.67e-13	33	178	53	194	ChainA, Lysozyme [Acinetobacter baumannii]
6H9D_A	2.48e-06	31	179	5	148	ChainA, Lysozyme [Asticcacaulis excentricus],6H9D_B Chain B, Lysozyme [Asticcacaulis excentricus],6H9D_C Chain C, Lysozyme [Asticcacaulis excentricus]
7M5I_A	3.02e-06	25	178	2	154	ChainA, Endolysin [Escherichia coli O157 typing phage 15],7M5I_B Chain B, Endolysin [Escherichia coli O157 typing phage 15]
5LXV_B	7.84e-06	581	629	26	70	Crystalstructure of Ruminococcus flavefaciens scaffoldin C cohesin in complex with a dockerin from an uncharacterized CBM-containing protein [Ruminococcus flavefaciens FD-1],5LXV_D Crystal structure of Ruminococcus flavefaciens scaffoldin C cohesin in complex with a dockerin from an uncharacterized CBM-containing protein [Ruminococcus flavefaciens FD-1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P07540	1.32e-13	30	179	1	144	Endolysin OS=Bacillus phage PZA OX=10757 GN=15 PE=3 SV=1
P11187	1.32e-13	30	179	1	144	Endolysin OS=Bacillus phage phi29 OX=10756 GN=15 PE=1 SV=1
Q37896	2.10e-12	30	217	1	184	Endolysin OS=Bacillus phage B103 OX=10778 GN=15 PE=3 SV=1
P62692	8.04e-11	30	177	1	136	Endolysin OS=Lactococcus phage c2 OX=31537 GN=L3 PE=3 SV=1
P62693	8.04e-11	30	177	1	136	Endolysin OS=Lactococcus phage phivML3 OX=10746 GN=L3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001061	0.957461	0.040468	0.000316	0.000333	0.000316

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004304_00266.