CAZyme Information: MGYG000004309_00181

Basic Information

• Species: Fusobacterium_B sp900542625
• Lineage: Bacteria; Fusobacteriota; Fusobacteriia; Fusobacteriales; Fusobacteriaceae; Fusobacterium_B; Fusobacterium_B sp900542625
• CAZyme ID: MGYG000004309_00181
• CAZy Family: GH32
• CAZyme Description: Sucrose-6-phosphate hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
456	MGYG000004309_1|CGC4	53103.6	5.2966

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004309	2339352	MAG	Israel	Asia

• Gene Location: Start: 183783; End: 185153 Strand: +

Full Sequence      

MKFLNFEKYTYLEDKHKDYLKELAEFVQTSKYLPKYHIYPETGLMNDPNGLAYFNGEYQV
FYQWFPFEASHGMKHWARSTSKDLINWERKGTALTPDKEYEKNGCYSGNAIEKDGKLYLF
YTANYKIENGRIPKQAVAIMDKEGKIEKYEGNPVIDGAPEGFTGDIRDPFVFEKNGAYYM
LIGGRTKKEEGKLLIYKSIDLLKWDYYGILEIGIKNIGFMYECPSYIKVDGKDVLIFSPM
GLAPNGDRYHNQFTSLYMIGEMDIESKRFVIENMDEIDCGFDFYAPQVFYGKDRRPLMFG
WFGCGEQVLPTDKDMWRHGLTIARELHVADNKLYTNPVKEIDSIFRKAELSQCLNCKPEN
PYYLVDTVIEKEEKPVVLQFGTDDDNWKLIIDFNKSKVTLDRNGLAQKFDTQYGLVRSCS
IETTDKVHLKIYVDNSFVEICINDGERMMSGRVFFI

Enzyme Prediction     

No EC number prediction in MGYG000004309_00181.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH32	37	337	8.2e-94	0.9965870307167235

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR01322	scrB_fam	3.90e-152	20	454	1	443	sucrose-6-phosphate hydrolase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
cd18623	GH32_ScrB-like	4.70e-150	43	330	1	289	glycoside hydrolase family 32 sucrose 6 phosphate hydrolase (sucrase). Glycosyl hydrolase family GH32 subgroup contains sucrose-6-phosphate hydrolase (sucrase, EC:3.2.1.26) among others. The enzyme cleaves sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose. These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
COG1621	SacC	3.53e-146	9	455	5	459	Sucrose-6-phosphate hydrolase SacC, GH32 family [Carbohydrate transport and metabolism].
pfam00251	Glyco_hydro_32N	2.01e-117	37	337	1	308	Glycosyl hydrolases family 32 N-terminal domain. This domain corresponds to the N-terminal domain of glycosyl hydrolase family 32 which forms a five bladed beta propeller structure.
smart00640	Glyco_32	4.21e-112	37	445	1	437	Glycosyl hydrolases family 32.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIY83614.1	2.15e-195	1	454	1	454
ALS36464.1	4.56e-180	7	454	6	460
CBL39319.1	1.48e-168	1	454	1	452
AQP38830.1	5.98e-168	1	454	1	452
AND40587.1	4.93e-137	7	454	7	465

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6NU7_A	3.72e-85	15	454	11	462	Structureof sucrose-6-phosphate hydrolase from Lactobacillus gasseri [Lactobacillus gasseri 224-1],6NU8_A Structure of sucrose-6-phosphate hydrolase from Lactobacillus gasseri in complex with fructose [Lactobacillus gasseri 224-1]
7BWB_A	5.05e-73	21	454	31	460	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 [Bombyx mori]
7BWC_A	7.63e-72	21	454	31	460	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 mutant D63A in complex with sucrose [Bombyx mori]
7VCO_A	1.21e-70	30	454	23	458	ChainA, Sucrose-6-phosphate hydrolase [Frischella perrara],7VCP_A Chain A, Sucrose-6-phosphate hydrolase [Frischella perrara]
1UYP_A	5.90e-60	32	445	2	397	Thethree-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_B The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_C The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_D The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_E The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_F The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q05936	9.11e-101	7	454	8	463	Sucrose-6-phosphate hydrolase OS=Staphylococcus xylosus OX=1288 GN=scrB PE=3 SV=1
P07819	2.09e-88	36	454	32	453	Sucrose-6-phosphate hydrolase OS=Bacillus subtilis (strain 168) OX=224308 GN=sacA PE=3 SV=2
P13522	8.24e-88	8	454	8	455	Sucrose-6-phosphate hydrolase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) OX=210007 GN=scrB PE=3 SV=3
P13394	1.47e-86	7	454	11	453	Sucrose-6-phosphate hydrolase OS=Vibrio alginolyticus OX=663 GN=scrB PE=2 SV=1
P43471	1.29e-85	8	454	8	461	Sucrose-6-phosphate hydrolase OS=Pediococcus pentosaceus OX=1255 GN=scrB PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004309_00181.