CAZyme Information: MGYG000004310_01170

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; Borkfalkiaceae; UBA10281
• CAZyme ID: MGYG000004310_01170
• CAZy Family: GT5
• CAZyme Description: Glycogen synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
567	MGYG000004310_13|CGC1	63597.29	8.2548

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004310	2112592	MAG	Israel	Asia

• Gene Location: Start: 32714; End: 34417 Strand: -

Full Sequence      

MAKTTVKNTEDKVEDKKKAKTAAIKKVVKEEKPVTAKKVVKEEKTAEAGKEVKKEKKATE
MPKTGEKTVENAMPNVAAGDVDFAVRTLNSVLFVASEANPYLGTGGLADVIGSLPKALAK
NGNYDVRVVMPLYGDIDQKYRTQMRFLMNFNVPLAWRNQYCGVFSLKADGVTFYFIDNEY
YFKRSGLYGYFDDGERYAFFSKAVLEMMVHLDYYPEILHCHDWQAALSVIYLKTLYANRY
GYDHIKALFTIHNIEYQGKYGYECLGDLFGLPESVKNVLDYEGCLNLMKGAIQFSDRFST
VSPMYANEIKNPFFAHGLQYAVCENEFKLSGILNGIDESVYNPATDEKLFKKYSVKDMSG
KAVCKSELQKMLGLPEKADAPLISVISRLVPAKGLELIKCVIEELLTENVQVVILGKGEG
EYEEFFKGIAARYSGKCRAIIAYNKDLASKLYSASDIFLMPSKQEPCGLSQMIACKYGAV
PVVRATGGLFDSIAPHNNAGRKGGNGFVFGNYNAHEMLYVIKDAIYTFGNKKEWNEIVKN
AMTTDFSWQKSSGEYEKLYDKMLGLIK

Enzyme Prediction     

No EC number prediction in MGYG000004310_01170.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT5	91	561	5e-174	0.9957627118644068

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03791	GT5_Glycogen_synthase_DULL1-like	0.0	91	559	2	472	Glycogen synthase GlgA and similar proteins. This family is most closely related to the GT5 family of glycosyltransferases. Glycogen synthase (EC:2.4.1.21) catalyzes the formation and elongation of the alpha-1,4-glucose backbone using ADP-glucose, the second and key step of glycogen biosynthesis. This family includes starch synthases of plants, such as DULL1 in Zea mays and glycogen synthases of various organisms.
PRK00654	glgA	0.0	91	564	3	465	glycogen synthase GlgA.
COG0297	GlgA	0.0	91	567	3	483	Glycogen synthase [Carbohydrate transport and metabolism].
TIGR02095	glgA	0.0	91	559	3	470	glycogen/starch synthase, ADP-glucose type. This family consists of glycogen (or starch) synthases that use ADP-glucose (EC 2.4.1.21), rather than UDP-glucose (EC 2.4.1.11) as in animals, as the glucose donor. This enzyme is found in bacteria and plants. Whether the name given is glycogen synthase or starch synthase depends on context, and therefore on substrate. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
PRK14099	PRK14099	1.39e-107	90	559	5	476	glycogen synthase GlgA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCI60006.1	2.56e-171	91	564	3	474
QEY34691.1	6.10e-170	91	563	3	472
CAB1243454.1	1.09e-167	91	563	3	472
QNO18264.1	1.58e-164	91	563	3	472
AGX05960.1	2.57e-164	91	563	3	475

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4HLN_A	3.98e-84	76	560	103	623	Structureof barley starch synthase I in complex with maltooligosaccharide [Hordeum vulgare]
3D1J_A	3.69e-82	91	562	3	476	ChainA, Glycogen synthase [Escherichia coli]
2QZS_A	1.27e-81	91	562	3	476	CrystalStructure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSb) [Escherichia coli],2R4T_A Crystal Structure of Wild-type E.coli GS in Complex with ADP and Glucose(wtGSc) [Escherichia coli],2R4U_A Crystal Structure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSd) [Escherichia coli],3GUH_A Crystal Structure of Wild-type E.coli GS in complex with ADP and DGM [Escherichia coli K-12]
3COP_A	9.71e-81	91	562	3	476	ChainA, Glycogen synthase [Escherichia coli],3CX4_A Chain A, Glycogen synthase [Escherichia coli]
6GNE_A	2.16e-77	91	561	12	496	Catalyticdomain of Starch Synthase IV from Arabidopsis thaliana bound to ADP and acarbose [Arabidopsis thaliana],6GNE_B Catalytic domain of Starch Synthase IV from Arabidopsis thaliana bound to ADP and acarbose [Arabidopsis thaliana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q97GX6	1.06e-153	91	563	3	477	Glycogen synthase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) OX=272562 GN=glgA PE=3 SV=1
A6TSC8	1.46e-150	91	559	3	471	Glycogen synthase OS=Alkaliphilus metalliredigens (strain QYMF) OX=293826 GN=glgA PE=3 SV=1
Q6HC18	8.58e-150	90	563	2	475	Glycogen synthase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) OX=281309 GN=glgA PE=3 SV=2
A0PY73	1.34e-149	90	563	2	476	Glycogen synthase OS=Clostridium novyi (strain NT) OX=386415 GN=glgA PE=3 SV=1
B9J2G5	2.43e-149	90	563	2	475	Glycogen synthase OS=Bacillus cereus (strain Q1) OX=361100 GN=glgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000081	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004310_01170.