CAZyme Information: MGYG000004313_00074

Basic Information

• Species: Aggregatibacter segnis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Pasteurellaceae; Aggregatibacter; Aggregatibacter segnis
• CAZyme ID: MGYG000004313_00074
• CAZy Family: GT51
• CAZyme Description: Biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
257	MGYG000004313_1|CGC2	30154.05	10.5732

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004313	1916258	MAG	Israel	Asia

• Gene Location: Start: 74841; End: 75614 Strand: -

Full Sequence      

MRKKKTIKFPFKLANLRNLSLRRLWLFRKFPTQSAVRFLYRFLLATLVATFAFRFIPIPY
SSYMLEQKVAHVFSGDFTYQTHYDWVSLEDISWQMQLAVIAAEDQNFPEHYGFDFTAIKR
AFLHNQKSNRIRGASTISQQTAKNLYLWHGQSWLRKAIEVPATLMLETLWSKKRILEVYL
NIAEFGEGIYGVEAASRFYFKKPAKNLSQNEAALLAAILPNPIIYKANAPGAYTKRRQLW
IQRQMEQLGKSYLETFN

Enzyme Prediction     

EC	2.4.1.129

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	79	245	9.7e-58	0.943502824858757

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00056	mtgA	2.27e-124	21	253	5	231	monofunctional biosynthetic peptidoglycan transglycosylase; Provisional
TIGR02070	mono_pep_trsgly	4.97e-100	25	249	2	222	monofunctional biosynthetic peptidoglycan transglycosylase. This family is one of the transglycosylases involved in the late stages of peptidoglycan biosynthesis. Members tend to be small, about 240 amino acids in length, and consist almost entirely of a domain described by pfam00912 for transglycosylases. Species with this protein will have several other transglycosylases as well. All species with this protein are Proteobacteria that produce murein (peptidoglycan). [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	9.35e-79	23	250	4	245	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
pfam00912	Transgly	4.30e-69	79	246	9	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
COG5009	MrcA	6.61e-40	86	249	70	234	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SQH64485.1	1.43e-176	1	257	1	257
QQB09752.1	1.43e-176	1	257	1	257
QUC06373.1	2.38e-175	1	257	1	257
AFI87270.1	7.30e-154	1	257	1	257
AMQ94448.1	7.30e-154	1	257	1	257

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NB6_A	7.42e-30	85	247	22	186	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
2OQO_A	7.42e-30	85	247	22	186	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
4OON_A	1.42e-24	86	249	42	206	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
5FGZ_A	5.79e-20	99	247	172	326	E.coli PBP1b in complex with FPI-1465 [Escherichia coli K-12],5HL9_A E. coli PBP1b in complex with acyl-ampicillin and moenomycin [Escherichia coli K-12],5HLA_A E. coli PBP1b in complex with acyl-cephalexin and moenomycin [Escherichia coli K-12],5HLB_A E. coli PBP1b in complex with acyl-aztreonam and moenomycin [Escherichia coli K-12],5HLD_A E. coli PBP1b in complex with acyl-CENTA and moenomycin [Escherichia coli K-12],6YN0_A Structure of E. coli PBP1b with a FtsN peptide activating transglycosylase activity [Escherichia coli K-12],7LQ6_A Chain A, Penicillin-binding protein 1B [Escherichia coli K-12]
3VMA_A	5.84e-20	99	247	193	347	CrystalStructure of the Full-Length Transglycosylase PBP1b from Escherichia coli [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q65S86	3.17e-111	5	254	4	242	Biosynthetic peptidoglycan transglycosylase OS=Mannheimia succiniciproducens (strain MBEL55E) OX=221988 GN=mtgA PE=3 SV=1
P44890	7.35e-101	37	253	26	243	Biosynthetic peptidoglycan transglycosylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=mtgA PE=3 SV=1
Q9CNV0	4.23e-100	33	257	18	246	Biosynthetic peptidoglycan transglycosylase OS=Pasteurella multocida (strain Pm70) OX=272843 GN=mtgA PE=3 SV=1
A5UDP3	7.14e-95	42	237	31	227	Biosynthetic peptidoglycan transglycosylase OS=Haemophilus influenzae (strain PittEE) OX=374930 GN=mtgA PE=3 SV=1
A7MJD8	2.33e-86	53	249	34	230	Biosynthetic peptidoglycan transglycosylase OS=Cronobacter sakazakii (strain ATCC BAA-894) OX=290339 GN=mtgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000003	0.000013	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
38	60