CAZyme Information: MGYG000004313_00951

Basic Information

• Species: Aggregatibacter segnis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Pasteurellaceae; Aggregatibacter; Aggregatibacter segnis
• CAZyme ID: MGYG000004313_00951
• CAZy Family: GH32
• CAZyme Description: Sucrose-6-phosphate hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
483	MGYG000004313_3|CGC1	55593.21	7.0205

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004313	1916258	MAG	Israel	Asia

• Gene Location: Start: 175685; End: 177136 Strand: +

Full Sequence      

MHIFNNGKYKSILAAASGELAEIAQTVQKDTNFRPHFHIAPPTGLLNDPNGLIFDGEKHH
LFYQWFPFDAIHGMKHWKHLITKDFQHYQSADDLIPCELFESHGCYSGGAIIWQEQIVAF
YTGNTRNAENQRIPHQNMAIFSKEGKLLSKRCLLNQAPKGYTEHVRDPKPFVTAEGKIRF
ILGVQREDLSGTALLYEMDDLNAEPHLLGELNIPAFDNRQVFMWECPDLFKLGGKDVFIW
SPQGKSREPHQFQNNYHAVYAVGKLEGLTFHAKHIAELDQGFDFYAPQTFAGLSKTENAI
LLGWIGLPDLTYPTDKFKWHSALTLPRELRLEGNKIHQRPIAKTYENLTALSTLKLDSKA
EIADLDRAYIKFEPNNQAFDLTFFQNEQGQSLRLSYKNRLVCLDRSQSEQTALMEKFGSK
RFCEIGNLQTVEIFFDYSVMEIFLNQGEKTMTSRFFIESRKNVVESNRKLTLQIGYPNPI
QYR

Enzyme Prediction     

EC	3.2.1.26

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH32	38	340	1.2e-76	0.9965870307167235

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1621	SacC	8.49e-154	9	456	5	458	Sucrose-6-phosphate hydrolase SacC, GH32 family [Carbohydrate transport and metabolism].
cd18623	GH32_ScrB-like	1.91e-131	44	333	1	289	glycoside hydrolase family 32 sucrose 6 phosphate hydrolase (sucrase). Glycosyl hydrolase family GH32 subgroup contains sucrose-6-phosphate hydrolase (sucrase, EC:3.2.1.26) among others. The enzyme cleaves sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose. These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
TIGR01322	scrB_fam	1.26e-126	27	457	8	444	sucrose-6-phosphate hydrolase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
pfam00251	Glyco_hydro_32N	5.52e-116	38	340	1	308	Glycosyl hydrolases family 32 N-terminal domain. This domain corresponds to the N-terminal domain of glycosyl hydrolase family 32 which forms a five bladed beta propeller structure.
smart00640	Glyco_32	3.95e-101	38	447	1	437	Glycosyl hydrolases family 32.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUC05178.1	0.0	1	483	1	483
QQB09257.1	5.61e-311	1	483	1	484
SQH65007.1	5.61e-311	1	483	1	484
QTO02264.1	9.65e-289	1	476	1	477
QOR15048.1	2.87e-288	1	482	1	483

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6NU7_A	2.28e-58	33	480	32	488	Structureof sucrose-6-phosphate hydrolase from Lactobacillus gasseri [Lactobacillus gasseri 224-1],6NU8_A Structure of sucrose-6-phosphate hydrolase from Lactobacillus gasseri in complex with fructose [Lactobacillus gasseri 224-1]
7BWB_A	6.26e-57	16	474	29	477	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 [Bombyx mori]
7BWC_A	8.96e-56	16	474	29	477	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 mutant D63A in complex with sucrose [Bombyx mori]
7VCO_A	9.54e-55	7	464	1	466	ChainA, Sucrose-6-phosphate hydrolase [Frischella perrara],7VCP_A Chain A, Sucrose-6-phosphate hydrolase [Frischella perrara]
1UYP_A	3.75e-39	33	361	2	311	Thethree-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_B The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_C The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_D The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_E The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_F The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P13394	8.42e-87	8	463	12	460	Sucrose-6-phosphate hydrolase OS=Vibrio alginolyticus OX=663 GN=scrB PE=2 SV=1
P07819	1.49e-82	19	456	14	453	Sucrose-6-phosphate hydrolase OS=Bacillus subtilis (strain 168) OX=224308 GN=sacA PE=3 SV=2
Q05936	5.50e-75	25	467	19	474	Sucrose-6-phosphate hydrolase OS=Staphylococcus xylosus OX=1288 GN=scrB PE=3 SV=1
A5EZZ8	1.49e-67	30	456	90	511	Probable sucrose-6-phosphate hydrolase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) OX=345073 GN=cscA PE=3 SV=1
P13522	6.50e-67	37	468	36	469	Sucrose-6-phosphate hydrolase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) OX=210007 GN=scrB PE=3 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004313_00951.