CAZyme Information: MGYG000004313_01058

Basic Information

• Species: Aggregatibacter segnis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Pasteurellaceae; Aggregatibacter; Aggregatibacter segnis
• CAZyme ID: MGYG000004313_01058
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
394	MGYG000004313_4|CGC1	44239.82	7.4827

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004313	1916258	MAG	Israel	Asia

• Gene Location: Start: 56761; End: 57945 Strand: -

Full Sequence      

MLNSISLNHSPTIAIIAGEVSGDILGAGLIHALKARYPHAKFIGIGGERMIAEGFETLFD
MEELSVMGLVEVLKHLPRLLKIRRSIIEQLSALKPDVFIGIDAPDFNLDVELKLKQQGIK
TIHYVSPSVWAWRQKRVYKIAAATNLVLAFLPFEKAFYDRFNVPCRFIGHTMADAIPLKP
NRDDACQLLNLDPAQRYVAMLVGSRGSEVEFLSEPFLQTAQLLHQRYPDVKFLVPLINQK
RRQQFEQIKQCVAPELDMILLDGNARAAMIAAEATLLASGTAALEAMLCKSPMVVGYRMK
PFTYFLAKHLVKTKYISLPNLLADEMLVPELIQEDCNPTKLAEKLSLYLSEDKSAVQNRH
VLLQRFAELHQMIQCNADQQAVQAVIDLLERSHG

Enzyme Prediction     

No EC number prediction in MGYG000004313_01058.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	13	374	2.3e-139	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR00215	lpxB	0.0	11	388	6	385	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
COG0763	LpxB	0.0	11	391	2	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
PRK00025	lpxB	0.0	10	394	1	380	lipid-A-disaccharide synthase; Reviewed
pfam02684	LpxB	4.55e-170	13	385	1	374	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
PRK01021	lpxB	2.37e-48	9	347	225	568	lipid-A-disaccharide synthase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SQH64259.1	2.46e-271	1	394	1	394
QQB09967.1	2.46e-271	1	394	1	394
QUC06160.1	1.17e-269	1	394	1	394
QTO01292.1	6.76e-269	1	394	1	394
SQI96724.1	7.86e-252	1	394	1	394

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	6.41e-158	12	390	8	382	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	1.29e-157	12	390	8	382	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A5UD44	6.47e-214	10	390	5	385	Lipid-A-disaccharide synthase OS=Haemophilus influenzae (strain PittEE) OX=374930 GN=lpxB PE=3 SV=1
P45011	9.18e-214	10	390	5	385	Lipid-A-disaccharide synthase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=lpxB PE=3 SV=2
Q4QLM6	9.18e-214	10	390	5	385	Lipid-A-disaccharide synthase OS=Haemophilus influenzae (strain 86-028NP) OX=281310 GN=lpxB PE=3 SV=1
Q65VI1	1.68e-213	7	390	9	392	Lipid-A-disaccharide synthase OS=Mannheimia succiniciproducens (strain MBEL55E) OX=221988 GN=lpxB PE=3 SV=1
Q9CJK7	2.31e-212	11	391	9	389	Lipid-A-disaccharide synthase OS=Pasteurella multocida (strain Pm70) OX=272843 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000072	0.000005	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004313_01058.