CAZyme Information: MGYG000004313_01108

Basic Information

• Species: Aggregatibacter segnis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Pasteurellaceae; Aggregatibacter; Aggregatibacter segnis
• CAZyme ID: MGYG000004313_01108
• CAZy Family: GT25
• CAZyme Description: Lipooligosaccharide biosynthesis protein lex-1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
220	MGYG000004313_4|CGC2	26271.34	6.7337

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004313	1916258	MAG	Israel	Asia

• Gene Location: Start: 110727; End: 111389 Strand: -

Full Sequence      

MSHFMLWKKCVDENLDYIALFEDDILLGEDAEKFLAESEWLKVRFNFQEIFVLRLETFLM
PVKIEKQQGILPFQQREIDILKSKHFGTAGYIISNAAARYLINVFEELSVDDVKAIDEIM
FNEWVNVESYQVYQLNPAICVQELQLNQESSTLTSGLQEERKKNTERYAKKTLQKHFSKK
ELEKRFFRVKENILRALNKKKWKERELAKEREGKEVIFFK

Enzyme Prediction     

No EC number prediction in MGYG000004313_01108.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT25	1	119	1.8e-19	0.6077348066298343

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3306	COG3306	1.26e-43	1	205	73	254	Glycosyltransferase involved in LPS biosynthesis, GR25 family [Cell wall/membrane/envelope biogenesis].
pfam01755	Glyco_transf_25	1.23e-33	1	120	72	200	Glycosyltransferase family 25 (LPS biosynthesis protein). Members of this family belong to Glycosyltransferase family 25 This is a family of glycosyltransferases involved in lipopolysaccharide (LPS) biosynthesis. These enzymes catalyze the transfer of various sugars onto the growing LPS chain during its biosynthesis.
cd06532	Glyco_transf_25	1.84e-10	1	39	69	118	Glycosyltransferase family 25 [lipooligosaccharide (LOS) biosynthesis protein] is a family of glycosyltransferases involved in LOS biosynthesis. The members include the beta(1,4) galactosyltransferases: Lgt2 of Moraxella catarrhalis, LgtB and LgtE of Neisseria gonorrhoeae and Lic2A of Haemophilus influenzae. M. catarrhalis Lgt2 catalyzes the addition of galactose (Gal) to the growing chain of LOS on the cell surface. N. gonorrhoeae LgtB and LgtE link Gal-beta(1,4) to GlcNAc (N-acetylglucosamine) and Glc (glucose), respectively. The genes encoding LgtB and LgtE are two genes of a five gene locus involved in the synthesis of gonococcal LOS. LgtE is believed to perform the first step in LOS biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AKU62975.1	1.20e-111	1	220	72	282
QUC06110.1	2.41e-111	1	219	72	281
SQI92463.1	1.32e-108	1	219	72	281
VEF42725.1	1.32e-108	1	219	72	281
AKS65832.1	1.32e-108	1	219	72	281

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q03974	3.95e-84	1	219	92	301	Lipooligosaccharide biosynthesis protein lex-1 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=lex1 PE=1 SV=1
Q51117	5.63e-43	1	220	67	280	Lacto-N-neotetraose biosynthesis glycosyltransferase LgtE OS=Neisseria meningitidis serogroup B (strain MC58) OX=122586 GN=lgtE PE=3 SV=2
Q50950	2.72e-40	1	220	67	280	Lacto-N-neotetraose biosynthesis glycosyltransferase LgtE OS=Neisseria gonorrhoeae OX=485 GN=lgtE PE=3 SV=1
Q51116	5.26e-39	1	161	67	229	Lacto-N-neotetraose biosynthesis glycosyltransferase LgtB OS=Neisseria meningitidis serogroup B (strain MC58) OX=122586 GN=lgtB PE=3 SV=2
P57033	6.99e-37	1	161	67	229	Lacto-N-neotetraose biosynthesis glycosyltransferase LgtB OS=Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491) OX=122587 GN=lgtB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000068	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004313_01108.