CAZyme Information: MGYG000004315_00715

Basic Information

• Lineage: Bacteria; Fusobacteriota; Fusobacteriia; Fusobacteriales; Leptotrichiaceae; Sneathia
• CAZyme ID: MGYG000004315_00715
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
275		31715.36	8.7551

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004315	953572	MAG	Israel	Asia

• Gene Location: Start: 230; End: 1057 Strand: -

Full Sequence      

MKVSLILATLGRYEEVKIFLDSLLNQTYKDFEVVIVDQNEDGSLDKLVQEYRKNLDINHI
KSNIRGISINRNKGLIFAKGHIVAFPDDDCEYEKNTIERAVNYLYDKPNSIYSCKTLQKG
ENYGTGIMSDKDEEIIIANVHKTIKSITFFVNFGNDDIPLFDSLLGVGAKFGSGEETDYV
LNLLHKGYTGHYFSKHIVYHPAKKGNYDDLDRAYKYALGFGALCKKEIVKRKEYGYYLIF
LNKVFRSIMGIIVTKNRKYHYTVLKGRLRGFIDYD

Enzyme Prediction     

No EC number prediction in MGYG000004315_00715.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	4	121	1.1e-21	0.7058823529411765

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00761	Glyco_tranf_GTA_type	3.26e-19	6	109	2	107	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
pfam00535	Glycos_transf_2	5.13e-18	4	139	1	138	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
COG0463	WcaA	7.50e-14	1	272	3	268	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
PRK10073	PRK10073	2.17e-11	2	89	7	95	putative glycosyl transferase; Provisional
COG1216	GT2	8.43e-11	1	275	3	295	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AKC95674.1	1.17e-138	1	275	1	275
ALA95870.1	4.97e-112	1	274	1	275
BBM36552.1	1.11e-111	1	274	1	275
BBM39397.1	3.42e-110	1	274	1	275
BBM57968.1	1.96e-109	1	274	1	275

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HEA_A	1.48e-08	3	171	7	183	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D4GYH3	6.02e-09	1	111	1	114	Glucosyl-dolichyl phosphate glucuronosyltransferase OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) OX=309800 GN=aglG PE=1 SV=1
Q48214	1.96e-07	4	184	3	182	Uncharacterized glycosyltransferase HI_1696 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_1696 PE=3 SV=2
Q4UM29	5.83e-07	2	129	294	420	Uncharacterized glycosyltransferase RF_0543 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) OX=315456 GN=RF_0543 PE=3 SV=1
Q1RIM7	1.09e-06	2	124	292	413	Uncharacterized glycosyltransferase RBE_0706 OS=Rickettsia bellii (strain RML369-C) OX=336407 GN=RBE_0706 PE=3 SV=1
Q0P9C6	5.34e-06	2	135	3	142	GalNAc(5)-diNAcBac-PP-undecaprenol beta-1,3-glucosyltransferase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) OX=192222 GN=pglI PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000045	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004315_00715.