CAZyme Information: MGYG000004315_00716

Basic Information

• Lineage: Bacteria; Fusobacteriota; Fusobacteriia; Fusobacteriales; Leptotrichiaceae; Sneathia
• CAZyme ID: MGYG000004315_00716
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
237		28698.41	8.9845

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004315	953572	MAG	Israel	Asia

• Gene Location: Start: 1059; End: 1772 Strand: -

Full Sequence      

MERIPRIAYYIWIGDKPKPKIFEKCHNSWIKYLKNFEIKELNEDNVDLKKYMENKFFRQC
YEKGLYAYCSDYIRADVLYKTGGVYLDIDMQLLRPIDDLLTYDFFIGYESDKYLGVGLYG
ASKNSIILKDLLEFYSKKIYEESLWTIPKILTHIIREKGYFNLENTKYLEERLFYPFSLN
EEFSKDCIKEDTYAIHWWNASWSNLKSKLFLETKHLHGIKKFLKKIKIILRVYLKGY

Enzyme Prediction     

No EC number prediction in MGYG000004315_00716.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	22	100	2.8e-19	0.9333333333333333

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3774	OCH1	1.45e-19	4	216	82	295	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
pfam04488	Gly_transf_sug	1.70e-10	19	105	1	92	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
pfam05704	Caps_synth	2.10e-05	10	135	49	188	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.
pfam12919	TcdA_TcdB	0.001	31	90	128	194	TcdA/TcdB catalytic glycosyltransferase domain. This domain represents the N-terminal glycosyltransferase from a set of toxins found in some bacteria. This domain in TcdB glycosylates the host RhoA protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AKC95675.1	5.69e-148	1	237	1	237
ACZ09248.1	3.62e-87	4	235	2	241
ALA95449.1	1.87e-83	4	234	2	244
BBM45972.1	2.62e-80	4	235	2	252
BBM36533.1	9.00e-80	4	235	2	245

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5UQW4	3.39e-09	4	216	2	227	Uncharacterized glycosyltransferase L373 OS=Acanthamoeba polyphaga mimivirus OX=212035 GN=MIMI_L373 PE=3 SV=1
Q9UNA3	1.19e-06	70	199	150	291	Alpha-1,4-N-acetylglucosaminyltransferase OS=Homo sapiens OX=9606 GN=A4GNT PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004315_00716.