CAZyme Information: MGYG000004315_00742

Basic Information

• Lineage: Bacteria; Fusobacteriota; Fusobacteriia; Fusobacteriales; Leptotrichiaceae; Sneathia
• CAZyme ID: MGYG000004315_00742
• CAZy Family: PL8
• CAZyme Description: Hyaluronate lyase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
649		75988.24	9.7086

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004315	953572	MAG	Israel	Asia

• Gene Location: Start: 1755; End: 3704 Strand: +

Full Sequence      

MKKIIILIFMMFMPLVNLAAIDNFDKIIMNWQEILIGDKYFDNSEQMINLQKKQDVNVEK
LWNSLNKNADRKYLWDFGVNNENSSNITKSYRNVQALSIAVMNSKSKFYKNEALLKDIYS
SLDWLKENKYSSKIEARGNWWDYEIGTPRAINDIFSMLYPIINKEYMRDYLKVITHFVPD
ADKMRGSVNPKLVMRALAANQTDISKVKIIQSALLKDEKGLIYARDCLNKIFPFVEKGDG
FYKDGSFIQHDSVAYTAAYGNVLIDGLSQIMTLLENTDYKLDSKNSENINFWIKESFAPI
MYKGLTMDMVKGRSVSREKSYVSSIEIIRSIIRLAQVQNNMEYKMLAKSLIKSNTYFDYV
KELNNYRDIYLAKKILEDKNIKPYDFTENILKFYENMDRVVYKNKFHNFAFAISMSSNKT
KYYEAMNGENVKGWHTGDGMTYLYNGDIRQFNDDYWATVDPYRLPGTTVELSERKDGQGS
VEAKKSIVSGKVINNRKANIKMHHNNFLDTLSLDKKWLIDNDKITFKGENIKFKSDKIVQ
TVIENRKLNDDTNYEIYINGKLVNLELNKKYIFNNVKEILFKVNKPNEGIKYVFKNPETL
NIVLENRSGSWKSINKSQSDKMIQRKYFVVTKTHTKQNDSYEYTIYPQK

Enzyme Prediction     

EC	4.2.2.1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL8	394	648	9.7e-76	0.9851301115241635

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd01083	GAG_Lyase	1.38e-149	23	649	1	619	Glycosaminoglycan (GAG) polysaccharide lyase family. This family consists of a group of secreted bacterial lyase enzymes capable of acting on glycosaminoglycans, such as hyaluronan and chondroitin, in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen. These are broad-specificity glycosaminoglycan lyases which recognize uronyl residues in polysaccharides and cleave their glycosidic bonds via a beta-elimination reaction to form a double bond between C-4 and C-5 of the non-reducing terminal uronyl residues of released products. Substrates include chondroitin, chondroitin 4-sulfate, chondroitin 6-sulfate, and hyaluronic acid. Family members include chondroitin AC lyase, chondroitin abc lyase, xanthan lyase, and hyalurate lyase.
pfam08124	Lyase_8_N	4.25e-89	31	318	1	287	Polysaccharide lyase family 8, N terminal alpha-helical domain. This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.
pfam02278	Lyase_8	8.53e-63	392	647	2	249	Polysaccharide lyase family 8, super-sandwich domain. This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AKS52111.1	3.78e-178	24	647	149	784
AKP03806.1	3.78e-178	24	647	149	784
QMT84146.1	3.78e-178	24	647	149	784
AHB61202.1	5.18e-143	19	647	332	963
BAM24016.1	1.38e-140	22	647	268	895

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1N7O_A	7.03e-139	30	647	11	630	ChainA, hyaluronidase [Streptococcus pneumoniae]
1OJM_A	1.24e-138	30	647	11	630	SpecificityAnd Mechanism Of Streptococcus Pneumoniae Hyaluronate Lyase: Complex With Unsulphated Chondroitin Disaccharide [Streptococcus pneumoniae]
1C82_A	1.32e-138	30	647	13	632	MechanismOf Hyaluronan Binding And Degradation: Structure Of Streptococcus Pneumoniae Hyaluronate Lyase In Complex With Hyaluronic Acid Disaccharide At 1.7 A Resolution [Streptococcus pneumoniae],1EGU_A Crystal Structure Of Streptococcus Pneumoniae Hyaluronate Lyase At 1.56 A Resolution [Streptococcus pneumoniae],1F9G_A Crystal Structure Of Streptococcus Pneumoniae Hyaluronate Lyase Cocrystallized With Ascorbic Acid [Streptococcus pneumoniae],1OJP_A Specificity And Mechanism Of Streptococcus Pneumoniae Hyaluronate Lyase: Complex With 6-sulphated Chondroitin Disaccharide [Streptococcus pneumoniae],1W3Y_A Crystal structure of S. pneumoniae hyaluronate lyase in complex with palmitoyl-vitamin C [Streptococcus pneumoniae],2BRP_A Crystal structure of S. pneumoniae hyaluronate lyase in complex with W249b [Streptococcus pneumoniae],2BRV_X Crystal structure of Streptococcus Pneumoniae Hyaluronate Lyase from 70percent saturated malonate. [Streptococcus pneumoniae],2BRW_A Crystal structure of Streptococcus Pneumoniae Hyaluronate Lyase from 30percent PEGMME. [Streptococcus pneumoniae],2BRW_B Crystal structure of Streptococcus Pneumoniae Hyaluronate Lyase from 30percent PEGMME. [Streptococcus pneumoniae]
1LOH_A	3.91e-138	30	647	11	630	ChainA, Hyaluronate Lyase [Streptococcus pneumoniae],1LXK_A Chain A, Hyaluronate Lyase [Streptococcus pneumoniae]
1OJN_A	5.19e-138	30	647	13	632	SpecificityAnd Mechanism Of Streptococcus Pneumoniae Hyaluronate Lyase: Complex Of The Tyr408phe Mutant With 6-sulphated Chondroitin Disaccharide [Streptococcus pneumoniae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q54873	1.14e-133	14	647	280	916	Hyaluronate lyase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=SP_0314 PE=1 SV=2
Q53591	2.93e-127	16	647	244	897	Hyaluronate lyase OS=Streptococcus agalactiae serotype III (strain NEM316) OX=211110 GN=hylB PE=1 SV=2
Q59801	5.45e-117	23	647	48	691	Hyaluronate lyase OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=hysA PE=3 SV=1
Q9AQS0	5.00e-85	20	649	25	648	Xanthan lyase OS=Bacillus sp. (strain GL1) OX=84635 GN=xly PE=1 SV=1
P0CZ01	1.22e-52	22	634	37	651	Hyaluronate lyase OS=Cutibacterium acnes (strain DSM 16379 / KPA171202) OX=267747 GN=PPA0380 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000276	0.999091	0.000162	0.000151	0.000146	0.000144

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004315_00742.