CAZyme Information: MGYG000004316_01006

Basic Information

• Species: Granulicatella adiacens
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Aerococcaceae; Granulicatella; Granulicatella adiacens
• CAZyme ID: MGYG000004316_01006
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
236	MGYG000004316_21|CGC1	26588.22	8.2849

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004316	1849304	MAG	Israel	Asia

• Gene Location: Start: 7186; End: 7896 Strand: -

Full Sequence      

MIKLKDKESGEIVAKRKKRKSKFAFHLVEWFKSLSKLTALLLVAVTSVLLAGTITWLSEN
KPQHKAETSTRETFIETLAPAAQKAYRDYGVLPSVSLAQAILESNWGESLLASKYYNLYG
VKATTSQPNVVLETAEFVNETWITINGRFRVYDSWADSVEAHAQLLAYGVDWDPTLYHKV
LGARNYKQAAQALQDAGYATDPTYAQKLIQMIEEHHLDQYDKLPSEETTVSVRRGS

Enzyme Prediction     

No EC number prediction in MGYG000004316_01006.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	79	217	5.8e-38	0.984375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	4.15e-71	31	222	7	189	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
PRK08581	PRK08581	6.60e-37	60	222	309	473	amidase domain-containing protein.
smart00047	LYZ2	1.03e-36	65	221	3	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
TIGR02541	flagell_FlgJ	2.59e-32	72	212	149	290	flagellar rod assembly protein/muramidase FlgJ. The N-terminal region of this protein acts directly in flagellar rod assembly. The C-terminal region is a flagellum-specific muramidase (peptidoglycan hydrolase) required for formation of the outer membrane L ring.
NF038016	sporang_Gsm	1.22e-31	70	221	159	312	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNG05268.1	2.12e-67	63	222	46	205
ASV82509.1	2.12e-67	63	222	46	205
QIV90156.1	2.12e-67	63	222	46	205
QXJ62039.1	2.12e-67	63	222	46	205
QQY22430.1	2.12e-67	63	222	46	205

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FI7_A	3.82e-26	66	221	24	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
3VWO_A	3.48e-19	72	219	2	150	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	4.29e-19	72	219	3	151	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]
5DN5_A	4.75e-19	74	214	6	147	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN4_A	6.72e-19	74	214	6	147	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	2.63e-39	67	223	44	200	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
Q9CIT4	6.21e-28	47	231	33	224	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=acmA PE=3 SV=1
A2RHZ5	2.22e-27	47	221	33	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris (strain MG1363) OX=416870 GN=acmA PE=3 SV=1
P0C2T5	4.24e-27	45	221	31	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris OX=1359 GN=acmA PE=3 SV=1
P75942	1.46e-18	72	214	150	293	Peptidoglycan hydrolase FlgJ OS=Escherichia coli (strain K12) OX=83333 GN=flgJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999977	0.000040	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004316_01006.