CAZyme Information: MGYG000004321_00265

Basic Information

• Species: Streptococcus constellatus
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus constellatus
• CAZyme ID: MGYG000004321_00265
• CAZy Family: GT28
• CAZyme Description: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
356		40204.6	9.4832

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004321	1789116	MAG	Israel	Asia

• Gene Location: Start: 58871; End: 59941 Strand: -

Full Sequence      

MKKIIFTGGGTVGHVTLNLLLIPKFLDAGWQVHYIGDKHGIEYKEIQKLGLNITFHSIAT
GKLRRYFSWQNMLDIFKVTWGILQSLGIMVKVRPQVLFSKGGFVSVPPVIAARLSRVPVY
VHESDLSIGLANKIAYKCATKMYSTFEQAHALTKIEHVGAVTKVGEKITAPNEQVQRIQQ
HFDKNLPTLLFVGGSAGAKVFNDLVTENKIELTQHYNVINLSGDAHLDELSNHLYRIAYV
TDLYQPLMNLADVVITRGGSNTIFELLAMAKLHVIVPLGREASRGDQIENADYFVKKGYA
KKLDEGQLNFENLQKVIAEMLERKEMYERTMKQSHEIKSLDEFYNLLTNDIDKGRK

Enzyme Prediction     

No EC number prediction in MGYG000004321_00265.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	188	338	3.6e-29	0.9681528662420382

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00726	murG	1.10e-131	1	347	1	348	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional
COG0707	MurG	7.69e-100	2	347	1	348	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
PRK12446	PRK12446	7.10e-95	1	332	1	334	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase; Reviewed
cd03785	GT28_MurG	3.50e-82	3	333	1	333	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
TIGR01133	murG	4.85e-62	2	343	1	347	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. RM 8449890 RT The final step of peptidoglycan subunit assembly in Escherichia coli occurs in the cytoplasm. RA Bupp K, van Heijenoort J. RL J Bacteriol 1993 Mar;175(6):1841-3 [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNL42944.1	3.16e-257	1	356	1	356
VEE80394.1	1.50e-255	1	356	1	356
VED98143.1	1.96e-251	1	356	1	356
AGU74081.1	3.05e-239	1	356	1	356
AGU79449.1	3.05e-239	1	356	1	356

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3S2U_A	2.92e-21	3	321	4	322	Crystalstructure of the Pseudomonas aeruginosa MurG:UDP-GlcNAc substrate complex [Pseudomonas aeruginosa PAO1]
1F0K_A	5.38e-21	2	318	7	320	The1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1F0K_B The 1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1NLM_A Crystal Structure Of Murg:glcnac Complex [Escherichia coli],1NLM_B Crystal Structure Of Murg:glcnac Complex [Escherichia coli]
7D1I_A	1.35e-16	2	332	10	345	ChainA, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_B Chain B, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_C Chain C, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A3CLN6	5.75e-199	1	356	1	356	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Streptococcus sanguinis (strain SK36) OX=388919 GN=murG PE=3 SV=1
A8AW15	1.10e-196	1	356	1	356	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288) OX=467705 GN=murG PE=3 SV=1
B1IAM4	1.36e-182	1	351	1	351	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Streptococcus pneumoniae (strain Hungary19A-6) OX=487214 GN=murG PE=3 SV=1
C1CQG5	2.74e-182	1	351	1	351	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Streptococcus pneumoniae (strain Taiwan19F-14) OX=487213 GN=murG PE=3 SV=1
C1CJF3	3.90e-182	1	351	1	351	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Streptococcus pneumoniae (strain P1031) OX=488223 GN=murG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000039	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004321_00265.