CAZyme Information: MGYG000004321_00425

Basic Information

• Species: Streptococcus constellatus
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus constellatus
• CAZyme ID: MGYG000004321_00425
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
200		23028.67	9.6806

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004321	1789116	MAG	Israel	Asia

• Gene Location: Start: 47727; End: 48329 Strand: -

Full Sequence      

MFKIFRKLIFLILLILVCYKFIQVHHDVKQVMNYRSLVREVLDEQDTVANEELVLAMIYT
ETKGKVSDVMQSSESATGQKNSILDNKESIRQGVQTLSTNLNVAQEKKVDVWTAVQAYNF
GRAYIDYIAKHGGENTLDLAKKYSKNIVAPSLGNVTGKTYSYYHPIALLHGSKLYINGGN
FYYSRQVRMNMYIMKVMNWF

Enzyme Prediction     

No EC number prediction in MGYG000004321_00425.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13702	Lysozyme_like	3.93e-79	28	190	1	164	Lysozyme-like.
cd16891	CwlT-like	5.89e-64	34	191	1	150	CwlT-like N-terminal lysozyme domain and similar domains. CwlT is a bifunctional cell wall hydrolase containing an N-terminal lysozyme domain and a C-terminal NlpC/P60 endopeptidase domain (gamma-d-D-glutamyl-L-diamino acid endopeptidase), and has been implicated in the spread of transposons. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
COG0741	MltE	2.50e-04	18	199	110	288	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEE81585.1	5.31e-137	1	200	1	200
AGU79863.1	5.31e-137	1	200	1	200
AGU72690.1	5.31e-137	1	200	1	200
AGU74446.1	5.31e-137	1	200	1	200
QNL41609.1	8.80e-136	1	200	1	200

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4FDY_A	1.27e-15	30	182	25	170	ChainA, Similar to lipoprotein, NLP/P60 family [Staphylococcus aureus subsp. aureus Mu50],4FDY_B Chain B, Similar to lipoprotein, NLP/P60 family [Staphylococcus aureus subsp. aureus Mu50]
4HPE_A	1.96e-13	30	196	23	182	ChainA, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_B Chain B, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_C Chain C, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_D Chain D, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_E Chain E, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_F Chain F, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9AHT6	6.44e-87	1	195	1	195	Pneumococcal vaccine antigen A OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=pvaA PE=4 SV=1
Q8DPY9	5.27e-86	1	195	1	195	Pneumococcal vaccine antigen A OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=pvaA PE=4 SV=1
Q8P120	1.45e-77	13	200	12	199	Pneumococcal vaccine antigen A homolog OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) OX=186103 GN=pvaA PE=3 SV=1
Q5XC63	2.93e-77	13	200	12	199	Pneumococcal vaccine antigen A homolog OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) OX=286636 GN=pvaA PE=3 SV=1
Q99ZN9	5.90e-77	13	200	12	199	Pneumococcal vaccine antigen A homolog OS=Streptococcus pyogenes serotype M1 OX=301447 GN=pvaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.886095	0.028103	0.083351	0.000138	0.000080	0.002247

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004321_00425.