CAZyme Information: MGYG000004321_01663

Basic Information

• Species: Streptococcus constellatus
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus constellatus
• CAZyme ID: MGYG000004321_01663
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
364		39819.47	9.1678

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004321	1789116	MAG	Israel	Asia

• Gene Location: Start: 31; End: 1125 Strand: +

Full Sequence      

MIVSGVSSPYGVREVKLPTWSSVNGQDDIIWYTATKQANGTYKVTVKASDHKNSTGLYYV
HLYYVQNNGTLIGVGGTSTNVTISPEKLKPTGKITIQNNNPNTGTFEVVVSNVFSPNGVR
EVKLPTWSSVNGQDDVSWYTATKQADGTYKLFVNASNHKNSTGEYNVHLYYVQNDGQLVG
VGGIKLQVSKRVYETPYYSQRDSRWAGRTYGGYTFAATGCVPTTVAMAISGITGQTVLPT
TVADYLYHSTNEFNKRSYGTTSHGIVLAARHWGLKTETLGSTAAVREALAMGHHVLGAVG
TSVFANYPVTHELIMKGYNNGMTYVMDPYNASNNGYYSVDYLFRVRSLDPTDNTEGSPFM
TIRA

Enzyme Prediction     

No EC number prediction in MGYG000004321_01663.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam08481	GBS_Bsp-like	6.24e-32	96	183	1	88	GBS Bsp-like repeat. This domain is found as a repeat in a number of Streptococcus proteins including some hypothetical proteins and Bsp. Bsp is a protein of group B Streptococcus (GBS) which might control cell morphology.
pfam08481	GBS_Bsp-like	1.22e-28	1	77	13	89	GBS Bsp-like repeat. This domain is found as a repeat in a number of Streptococcus proteins including some hypothetical proteins and Bsp. Bsp is a protein of group B Streptococcus (GBS) which might control cell morphology.
cd02549	Peptidase_C39A	4.56e-17	214	342	1	126	A sub-family of peptidase family C39. Peptidase family C39 mostly contains bacteriocin-processing endopeptidases from bacteria. The cysteine peptidases in family C39 cleave the "double-glycine" leader peptides from the precursors of various bacteriocins (mostly non-lantibiotic). The cleavage is mediated by the transporter as part of the secretion process. Bacteriocins are antibiotic proteins secreted by some species of bacteria that inhibit the growth of other bacterial species. The bacteriocin is synthesized as a precursor with an N-terminal leader peptide, and processing involves removal of the leader peptide by cleavage at a Gly-Gly bond, followed by translocation of the mature bacteriocin across the cytoplasmic membrane. Most endopeptidases of family C39 are N-terminal domains in larger proteins (ABC transporters) that serve both functions. The proposed protease active site is conserved in this sub-family of proteins with a single peptidase domain, which are lacking the nucleotide-binding transporter signature or have different domain architectures.
pfam13529	Peptidase_C39_2	6.93e-05	194	328	1	139	Peptidase_C39 like family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGU74878.1	7.24e-262	1	364	575	938
AGU73124.1	7.24e-262	1	364	575	938
AGU80269.1	7.24e-262	1	364	575	938
VEE82607.1	1.28e-253	1	364	989	1352
QNL41970.1	2.04e-248	1	364	884	1248

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.892393	0.106437	0.000608	0.000194	0.000129	0.000273

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004321_01663.