CAZyme Information: MGYG000004324_01526

Basic Information

• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella
• CAZyme ID: MGYG000004324_01526
• CAZy Family: GH28
• CAZyme Description: Polygalacturonase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
227		24795.13	4.8699

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004324	1854884	MAG	Israel	Asia

• Gene Location: Start: 56; End: 739 Strand: +

Full Sequence      

MGDDCIAIKSGKLGIEPELRPATHDVLISHCYMHDGHGAVVLGSEAAGGIKDLTVSKCLF
ERTDRGLRVKTRRGRGKDAVNEGITFEHIRMDEVLTPFVVNSFYFCDKDGKTDYVQSREA
LPVDDRTPGFGATTFCDIEATNCHAAAAYITGLPESKVTRLTFQDVHVTFADDAEPFVPA
MACGVEPMVRQGIIAQNVKVLDLQNVVIEGQDGEELQLQNVDKVVRA

Enzyme Prediction     

No EC number prediction in MGYG000004324_01526.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	2	173	1.7e-31	0.44

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG5434	Pgu1	2.95e-40	2	222	308	529	Polygalacturonase [Carbohydrate transport and metabolism].
PLN02218	PLN02218	1.93e-10	2	113	263	363	polygalacturonase ADPG
PLN03010	PLN03010	1.21e-09	2	178	228	384	polygalacturonase
pfam00295	Glyco_hydro_28	1.44e-09	2	110	159	255	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
PLN02793	PLN02793	9.43e-09	2	107	248	342	Probable polygalacturonase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIA34431.1	3.02e-159	1	227	305	531
ATP54717.1	7.57e-155	1	227	305	531
QUC03565.1	2.97e-113	1	226	304	529
QOL31033.1	9.60e-103	1	224	303	526
QOL34309.1	9.60e-103	1	224	303	526

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2UVE_A	3.29e-07	2	118	401	514	Structureof Yersinia enterocolitica Family 28 Exopolygalacturonase [Yersinia enterocolitica],2UVE_B Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase [Yersinia enterocolitica],2UVF_A Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase in Complex with Digalaturonic Acid [Yersinia enterocolitica],2UVF_B Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase in Complex with Digalaturonic Acid [Yersinia enterocolitica]
3JUR_A	4.24e-06	2	76	259	335	Thecrystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_B The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_C The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_D The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P27644	7.73e-35	1	202	92	295	Polygalacturonase OS=Rhizobium radiobacter OX=358 GN=pgl PE=2 SV=1
P15922	3.78e-08	2	118	394	507	Exo-poly-alpha-D-galacturonosidase OS=Dickeya chrysanthemi OX=556 GN=pehX PE=1 SV=1
P48979	5.76e-08	2	174	218	371	Polygalacturonase OS=Prunus persica OX=3760 PE=2 SV=1
Q9LW07	6.70e-07	2	124	209	318	Probable polygalacturonase At3g15720 OS=Arabidopsis thaliana OX=3702 GN=At3g15720 PE=3 SV=1
A7PZL3	9.29e-07	2	219	270	481	Probable polygalacturonase OS=Vitis vinifera OX=29760 GN=GSVIVT00026920001 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000071	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004324_01526.