CAZyme Information: MGYG000004325_00303

Basic Information

• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella
• CAZyme ID: MGYG000004325_00303
• CAZy Family: CBM32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
356		38781.24	10.0458

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004325	2029971	MAG	Israel	Asia

• Gene Location: Start: 29433; End: 30503 Strand: +

Full Sequence      

MRRNSIFTKRWVKGSAVLVATAATLVFANPQQAIATPLKGVDSATVSQSASNVVDIDFAD
GIKGRITFLEDGIFRYNVDPKGEFSEYATPRSKSHTAKIQAQPDTSDTYSKPSATVADKG
DAIEITGGKATVILDKATGKMSIKSGDRGVVSESAPLDLDKKGTVQTLAKEKSENFFGGG
TQNGRFLHTNQTIAISNTNNWTDGGVASPNPFYWTSDGYGVLRNTFAEGSYDFGSTDSST
VTTLHSENEFDAYYFVATNEGASNVATEMLQDYYKVTGNPVLLPEYGFYLGHLNAYNRDG
WQRPRVKRSGRPRAASPRARRATLSTNLACRRATSSTAHLRPRRSMVRVLRSIPRT

Enzyme Prediction     

No EC number prediction in MGYG000004325_00303.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14752	GH31_N	1.68e-20	164	278	10	122	N-terminal domain of glycosyl hydrolase family 31 (GH31). This family is found N-terminal to the glycosyl-hydrolase domain of Glycoside hydrolase family 31 (GH31). GH31 includes the glycoside hydrolases alpha-glucosidase (EC 3.2.1.20), alpha-1,3-glucosidase (EC 3.2.1.84), alpha-xylosidase (EC 3.2.1.177), sucrase-isomaltase (EC 3.2.1.48 and EC 3.2.1.10), as well as alpha-glucan lyase (EC 4.2.2.13). All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. In most cases, the pyranose moiety recognized in subsite-1 of the substrate binding site is an alpha-D-glucose, though some GH31 family members show a preference for alpha-D-xylose. Several GH31 enzymes can accommodate both glucose and xylose and different levels of discrimination between the two have been observed. Most characterized GH31 enzymes are alpha-glucosidases. In mammals, GH31 members with alpha-glucosidase activity are implicated in at least three distinct biological processes. The lysosomal acid alpha-glucosidase (GAA) is essential for glycogen degradation and a deficiency or malfunction of this enzyme causes glycogen storage disease II, also known as Pompe disease. In the endoplasmic reticulum, alpha-glucosidase II catalyzes the second step in the N-linked oligosaccharide processing pathway that constitutes part of the quality control system for glycoprotein folding and maturation. The intestinal enzymes sucrase-isomaltase (SI) and maltase-glucoamylase (MGAM) play key roles in the final stage of carbohydrate digestion, making alpha-glucosidase inhibitors useful in the treatment of type 2 diabetes. GH31 alpha-glycosidases are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues of the catalytic domain have been identified as the catalytic nucleophile and the acid/base, respectively. A loop of the N-terminal beta-sandwich domain is part of the active site pocket.
COG1501	YicI	7.25e-10	73	299	62	279	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
pfam16338	DUF4968	4.55e-09	52	143	1	79	Domain of unknown function (DUF4968). This family consists of uncharacterized proteins around 830 residues in length and is mainly found in various Bacteroides species. Several proteins in this family are annotated as alpha-glucosidases, but the function of this protein is unknown.
cd06596	GH31_CPE1046	1.17e-07	276	301	1	26	Clostridium CPE1046-like. CPE1046 is an uncharacterized Clostridium perfringens protein with a glycosyl hydrolase family 31 (GH31) domain. The domain architecture of CPE1046 and its orthologs includes a C-terminal fibronectin type 3 (FN3) domain and a coagulation factor 5/8 type C domain in addition to the GH31 domain. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
PRK10658	PRK10658	5.20e-07	111	290	89	270	putative alpha-glucosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOY60730.1	9.31e-116	32	301	46	315
QWT17625.1	1.03e-100	17	301	21	312
QNM10857.1	1.08e-94	46	302	50	307
BCT46261.1	3.45e-87	46	301	49	304
QUO30799.1	2.95e-86	49	301	35	287

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6M76_A	1.47e-70	42	301	32	294	GH31alpha-N-acetylgalactosaminidase from Enterococcus faecalis [Enterococcus faecalis ATCC 10100],6M77_A GH31 alpha-N-acetylgalactosaminidase from Enterococcus faecalis in complex with N-acetylgalactosamine [Enterococcus faecalis ATCC 10100]
7F7Q_A	1.47e-70	42	301	32	294	ChainA, GH31 alpha-N-acetylgalactosaminidase [Enterococcus faecalis ATCC 10100]
7F7R_A	1.47e-70	42	301	32	294	ChainA, GH31 alpha-N-acetylgalactosaminidase [Enterococcus faecalis ATCC 10100]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000460	0.998593	0.000237	0.000257	0.000226	0.000187

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004325_00303.