CAZyme Information: MGYG000004329_00571

Basic Information

• Species: Prevotellamassilia sp900539625
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotellamassilia; Prevotellamassilia sp900539625
• CAZyme ID: MGYG000004329_00571
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1124	MGYG000004329_7|CGC1	123705.43	6.5127

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004329	2571737	MAG	Israel	Asia

• Gene Location: Start: 11445; End: 14819 Strand: +

Full Sequence      

MRNLQKYIALTAFALPMAQQAQTVIGFEDESQFKSIGVYDSWAHSPFRTGALKGNVQIVD
NDQLNAPDAETGVVPNGTAKLLAFQRSRFAGNLFGARIDLKEPIKLTPKKQFVHVMIHKE
KAGRVMLIGLGKRPERVGQKETEQFTVLSSKTITPGKWQDAVFAINGAEGAEVNALVVVP
DCESTHNLAADFAAYIDEIEVNSSGASRIVYGIYPINFPKNTKQSRSDRYTSSIGFSCAS
SGKQTIAVNQKTTQKLYTEVFSEGFCVKPGESVTPTVNYTPGTWMHSYVYLDKGNDGRFD
VEIVDDGTLPEASDLVSYSYYEGKNSLGASANAGSAVQPPSFTIPADMKPGFYRLRYKVD
WDCTDAGGNDTPGNLIAANGGVIVDTRLNVHNDMVTIYRATAANGGGLNGDILKADGTDF
TTEEIPFGKPYTIKAQPAPGFVLSHVVLRHGYGLDGDSLLNDTPQYEDVIIPAYLFKDGA
YTIPAKYVDGTVRLIPYFSSRTSSFVTDDDYGTHFDKATATVTRTDRRLTALKFIAKKGG
TSTLGLGSSGDNFVYRDMTKKEVSVLPGDEVKTTITYRGKSMQAYLYIDFNQDGQFDAVL
DANGRPTPSSELIAYNYFNGRNSDGKEITADPADVAINTMPAFRIPEMLPTGNYRARLKV
DFNNIDPAGQWAKGGENNIDDNGGNVVDFLLNVHNDSHKLDVNTVNGSVHGTAASGLPPR
VKPFTALAVRAVPVAEGYKTKGMVIRHGHNLNGPQYIRGNRQWSEYTRTAISNYSIPKDS
VNGDVEINVTYEPTSSATYELVFADEFNTADGTQPNDAYWSRCTRQNPTWKRFLSKNKQE
HELTGYIEDGKFVARCVPNPFKATDNVDMISGGIQTYGKFSVRYGKIEARLLTNGHTGNF
PAFWMMPQDNSAGWPYGGEIDIWEQINNENVSYHTIHSRWANGTSDGSLCQGQGNNPKKG
GTMSNVTTGNYHTFTLEWNEKLLTWYVDGIKAFSYAKSNKQSDLDLGQWPFDKAFHIIIN
QSVGNGSWAANCDTGHVYETLFDWVRVYQTKDQMSTGIVTVPEESLLKVNVTKGQINVSA
SKPMMVSVYDLYGRCLSSEKVSGDKTYKMNHGIYFVNNTKVLVP

Enzyme Prediction     

No EC number prediction in MGYG000004329_00571.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	804	1048	3.5e-45	0.991304347826087

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd08023	GH16_laminarinase_like	2.86e-54	803	1048	1	235	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
cd08024	GH16_CCF	7.24e-22	871	1035	101	288	Coelomic cytolytic factor, member of glycosyl hydrolase family 16. Subgroup of glucanases of unknown function that are related to beta-GRP (beta-1,3-glucan recognition protein), but contain active site residues. Beta-GRPs are one group of pattern recognition receptors (PRRs), also referred to as biosensor proteins, that complexes with pathogen-associated beta-1,3-glucans and then transduces signals necessary for activation of an appropriate innate immune response. Beta-GRPs are present in insects and lack all catalytic residues. This subgroup contains related proteins that still contain the active site and are widely distributed in eukaryotes. Their structures adopt a jelly roll fold with a deep active site channel harboring the catalytic residues, like those of other glycosyl hydrolase family 16 members.
cd02182	GH16_Strep_laminarinase_like	3.45e-21	799	1049	2	259	Streptomyces laminarinase-like, member of glycosyl hydrolase family 16. Proteins similar to Streptomyces sioyaensis beta-1,3-glucanase (laminarinase) present in Actinomycetales as well as Peziomycotina. Laminarinases belong to glycosyl hydrolase family 16 and hydrolyze the glycosidic bond of the 1,3-beta-linked glucan, a major component of fungal and plant cell walls and the structural and storage polysaccharides (laminarin) of marine macro-algae. Members of the GH16 family have a conserved jelly roll fold with an active site channel.
cd00413	Glyco_hydrolase_16	6.68e-20	805	1048	1	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
pfam00722	Glyco_hydro_16	1.07e-19	871	1046	22	168	Glycosyl hydrolases family 16.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFQ12302.1	8.38e-151	3	815	6	803
QFQ13169.1	2.52e-94	504	1049	18	541
QUB65408.1	3.11e-74	794	1120	43	331
QUB63276.1	1.54e-73	794	1122	43	333
AUI55248.1	1.04e-72	781	1122	31	333

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6T2R_AAA	7.54e-33	794	1051	24	264	ChainAAA, Beta-glycosidase [Bacteroides caccae]
6JH5_A	1.41e-22	874	1052	70	235	Structureof Marine bacterial laminarinase [Aquimarina]
4CRQ_A	2.07e-22	799	1049	3	231	Crystalstructure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S [Zobellia galactanivorans],4CRQ_B Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S [Zobellia galactanivorans],4CTE_A Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S in complex with a thio-oligosaccharide [Zobellia galactanivorans],4CTE_B Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S in complex with a thio-oligosaccharide [Zobellia galactanivorans]
3ATG_A	4.68e-22	800	1048	4	238	endo-1,3-beta-glucanasefrom Cellulosimicrobium cellulans [Cellulosimicrobium cellulans]
6JHJ_A	8.79e-22	874	1052	70	235	Structureof Marine bacterial laminarinase mutant-E135A [Aquimarina],6JIA_A Marine bacterial laminarinase mutant E135A complex with laminaritetraose [Aquimarina sp.],6M6P_A Structure of Marine bacterial laminarinase mutant E135A in complex with 1,3-beta-cellotriosyl-glucose [Aquimarina sp.]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9ZG90	7.94e-35	787	1049	46	288	Keratan-sulfate endo-1,4-beta-galactosidase OS=Sphingobacterium multivorum OX=28454 PE=1 SV=1
P23903	1.94e-19	741	1049	366	680	Glucan endo-1,3-beta-glucosidase A1 OS=Niallia circulans OX=1397 GN=glcA PE=1 SV=1
P45798	5.88e-19	799	1049	40	283	Beta-glucanase OS=Rhodothermus marinus OX=29549 GN=bglA PE=1 SV=1
Q27082	9.56e-13	783	1049	13	253	Clotting factor G alpha subunit OS=Tachypleus tridentatus OX=6853 PE=1 SV=1
C1IE32	1.32e-09	848	1024	65	237	Glucan endo-1,3-beta-glucosidase OS=Cryptopygus antarcticus OX=187623 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000484	0.998670	0.000267	0.000190	0.000190	0.000173

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004329_00571.