CAZyme Information: MGYG000004329_00623

Basic Information

• Species: Prevotellamassilia sp900539625
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotellamassilia; Prevotellamassilia sp900539625
• CAZyme ID: MGYG000004329_00623
• CAZy Family: PL8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1081	MGYG000004329_7|CGC2	118069.74	9.1481

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004329	2571737	MAG	Israel	Asia

• Gene Location: Start: 78044; End: 81289 Strand: +

Full Sequence      

MKKNSYSVRGGFLRNAKRALLTLAISSAALPASADVFQQIIDNVVARELSTSNVTSLVAS
AKTYMGNMKDDGSWPDVNYASKAQTNWPAMTHLNRLKTLAVAYVSPGSALKGDENLYAQI
VSGLNYWYAKKPVSTNWWYWEIGWPQEMGVILCLMRSGEKQLPESTEKNILAWQKSISKG
PNQSGSQGSGANKMDIALQWIYRTALQKDKSNLDFAVNQFFLPVKFNTGEGLQSDYSYLQ
HGMQLYAGGYGGSVLTATIKVAYYLVGTSYAEQGDYLNYISGFVRYGYLPSVRGQYMSFN
NVGRSVALPNGMLRSSFSTITTAMTDLDRAHAEEFNAATLRLKGSKQPGYGVAPFHRHYW
RADYTVHQRPDYNIDVRTASTRTLRCENGNGANLKGYFLTEGSTWIARTGKEYADISVVW
DWAHLPGTTVPAVSAIPQPRQWGTKGQSTFTGGVSDGTYGVMTYQMNNTEYSLNTQAKKS
WFFFDNEVVCLGSDIRSSNANAVHTTINQCLSSGPISLAAADGRSSETLTAAGQVSRNDV
AWVNHDSISYFFPQGGEVVLSDTTQSGTWKSVDSASSNTTVQKKRVFKLYLNHGEQPSGA
TYAYYIVPNTGNISDARERIDSLLVVNTDSVQAVFNPSLDMLQAVFHRAAKLSVGKMEVS
ATAPCAALFREVNAKEVRAFVSDPSYELDSLTIYAKFPALKYKELKCKFNTETMYKGSTS
AFVVNESTPDSVYRRVDTLTLNASELSFGNSTLSAQLKAAVLPLNASRPLTKWESSNNQI
VRVDQNGRVLALRSGEADVKVSVDDGLEATCHVVVAPGVATSFATADAYVYDKQGTTNFG
SAPTLVVRNDGTNYRRAAYVRFPLEALDSLDLTAGKAEVKLLFQVLSGSEKVSEVKWTVS
SLKSQAWTENAVTWNNGPSVLSQQTTSPCFIPSKDWTSNFVTFDVTSYALSRYKSGAKDL
SVYIYQNARATGGKGTSEFASRENAAGYIFAPRLVVVGSEHVTGISSPATTASAPHAALQ
GDILTIQTSAPAENVLYNVGGIPVRAFLVNQPGVYSYNVAALGRGVYLLKMNHETVRLIK
R

Enzyme Prediction     

No EC number prediction in MGYG000004329_00623.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL8	356	609	1.9e-94	0.9919678714859438

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd01083	GAG_Lyase	2.82e-128	37	684	2	693	Glycosaminoglycan (GAG) polysaccharide lyase family. This family consists of a group of secreted bacterial lyase enzymes capable of acting on glycosaminoglycans, such as hyaluronan and chondroitin, in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen. These are broad-specificity glycosaminoglycan lyases which recognize uronyl residues in polysaccharides and cleave their glycosidic bonds via a beta-elimination reaction to form a double bond between C-4 and C-5 of the non-reducing terminal uronyl residues of released products. Substrates include chondroitin, chondroitin 4-sulfate, chondroitin 6-sulfate, and hyaluronic acid. Family members include chondroitin AC lyase, chondroitin abc lyase, xanthan lyase, and hyalurate lyase.
pfam02278	Lyase_8	1.80e-89	356	610	1	251	Polysaccharide lyase family 8, super-sandwich domain. This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.
pfam08124	Lyase_8_N	1.46e-50	37	334	18	311	Polysaccharide lyase family 8, N terminal alpha-helical domain. This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.
NF033679	DNRLRE_dom	2.10e-20	826	997	1	164	DNRLRE domain. The DNRLRE domain, with a length of about 160 amino acids, appears typically in large, repetitive surface proteins of bacteria and archaea, sometimes repeated several times. It occurs, notably, three times in the C-terminal region of the enzyme disaggregatase from the archaeal species Methanosarcina mazei, each time with the motif DNRLRE, for which the domain is named. Archaeal proteins within this family are described particularly well by the currently more narrowly defined Pfam model, PF06848. Note that the catalytic region of disaggregatase, in the N-terminal portion of the protein, is modeled by a different HMM, PF08480.
pfam02884	Lyase_8_C	5.35e-11	627	692	3	67	Polysaccharide lyase family 8, C-terminal beta-sandwich domain. This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIK61519.1	2.94e-219	34	1071	44	1171
QIK56167.1	5.83e-219	34	985	44	1081
ASZ13140.1	1.19e-199	52	1070	57	983
QEH43022.1	4.70e-167	17	1013	2	888
ALJ58172.1	4.85e-164	19	722	15	708

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1CB8_A	1.65e-138	61	684	28	639	CHONDROITINASEAC LYASE FROM FLAVOBACTERIUM HEPARINUM [Pedobacter heparinus]
1HM2_A	3.15e-138	61	684	50	661	ACTIVESITE OF CHONDROITINASE AC LYASE REVEALED BY THE STRUCTURE OF ENZYME-OLIGOSACCHARIDE COMPLEXES AND MUTAGENESIS [Pedobacter heparinus],1HM3_A Active Site Of Chondroitinase Ac Lyase Revealed By The Structure Of Enzyme-Oligosaccharide Complexes And Mutagenesis [Pedobacter heparinus],1HMU_A ACTIVE SITE OF CHONDROITINASE AC LYASE REVEALED BY THE STRUCTURE OF ENZYME-OLIGOSACCHARIDE COMPLEXES AND MUTAGENESIS [Pedobacter heparinus],1HMW_A Active Site Of Chondroitinase Ac Lyase Revealed By The Structure Of Enzyme-oligosaccharide Complexes And Mutagenesis [Pedobacter heparinus]
2E24_A	1.48e-40	74	685	43	698	ChainA, Xanthan lyase [Bacillus sp. GL1]
2E22_A	6.15e-40	74	685	43	698	Crystalstructure of xanthan lyase in complex with mannose [Bacillus sp. GL1]
1J0M_A	2.56e-39	74	685	43	698	CrystalStructure of Bacillus sp. GL1 Xanthan Lyase that Acts on Side Chains of Xanthan [Bacillus sp. GL1],1J0N_A Crystal Structure of Bacillus sp. GL1 Xanthan Lyase that Acts on Side Chains of Xanthan [Bacillus sp. GL1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q59288	1.72e-137	61	684	50	661	Chondroitinase-AC OS=Pedobacter heparinus (strain ATCC 13125 / DSM 2366 / CIP 104194 / JCM 7457 / NBRC 12017 / NCIMB 9290 / NRRL B-14731 / HIM 762-3) OX=485917 GN=cslA PE=1 SV=1
Q9AQS0	7.90e-39	74	685	68	723	Xanthan lyase OS=Bacillus sp. (strain GL1) OX=84635 GN=xly PE=1 SV=1
Q54873	7.34e-20	73	636	335	946	Hyaluronate lyase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=SP_0314 PE=1 SV=2
Q53591	9.75e-16	95	614	322	903	Hyaluronate lyase OS=Streptococcus agalactiae serotype III (strain NEM316) OX=211110 GN=hylB PE=1 SV=2
P59807	2.10e-08	364	606	630	877	Chondroitin sulfate ABC endolyase OS=Proteus vulgaris OX=585 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000377	0.998918	0.000199	0.000185	0.000160	0.000141

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004329_00623.