CAZyme Information: MGYG000004334_01750

Basic Information

• Species: Ruminococcus_E sp002493635
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; Ruminococcus_E; Ruminococcus_E sp002493635
• CAZyme ID: MGYG000004334_01750
• CAZy Family: CBM74
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
753		81583.14	4.2003

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004334	2103818	MAG	Israel	Asia

• Gene Location: Start: 9984; End: 12245 Strand: -

Full Sequence      

MQKSKRIISIVIAMMIMVSMLAVAAVTTSAAASGSQVYFDNSKYNWEQVYVYAYGTKENA
KWPGQLMELDGSGLYTKSFPSTYKSENIIFTNGLEKGEGKEQYPEAAGLALNSGECKMLT
ADLQWVDYGKPDDHGYGFAYEASGKGFSSDYLAVKLGLKNADKGYYSIDGSPKTEYANGD
TIKVGEGKIANTAVTLVLTATGSDGVETTQTYTYKKSFTETKTTFSSSSDGHTTDAETGY
YDTNPNLQLGKYKTITVDGNLDDWDSSMIIAQGQANDDPRVYMPSSMHEQPWDAYALYAA
WDDDNLYFMWELANTSYIISPSDNFAASNEARPWRNSVPMYLALSVDPAKQATGAAVGTN
KDGSTYTNPFVWGCAGGVAKDGGTSFTTHIDTLVAMDSNNSNGGASIFKADTLADDGTYM
FNYDTRVPIGVINFQAQDNRNGFKIKYANGTKSTSLYGINAPKGSRVMGDNLDVNSNFAD
FFDLGYKADYGYIYEVAIPLSTLNIDREYIETKGIGAMQILTYGTSAMDTLPHDPSVLDN
ANVEYSYDPSTSHEKEDIDNITVPLARIGALLPDTIINEAPLEVNFGADKSSGQAVNTNI
TLSADAYHATGNVNYEFKVNGKTIQNSESSSASWTPTETGTYEISVIATDSKTSVVSTKT
FSVGAAGAYVPEPTTSPIETTEPTTSVDYKLGDVDMDGTVSIVDATLIQKYSAEMCTFTD
KQSELADTDKNGKIEINDATLIQKFLAEMIESL

Enzyme Prediction     

No EC number prediction in MGYG000004334_01750.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM74	241	567	3.6e-126	0.9967948717948718

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14256	Dockerin_I	5.11e-14	691	747	1	57	Type I dockerin repeat domain. Bacterial cohesin domains bind to a complementary protein domain named dockerin, and this interaction is required for the formation of the cellulosome, a cellulose-degrading complex. The cellulosome consists of scaffoldin, a noncatalytic scaffolding polypeptide, that comprises repeating cohesion modules and a single carbohydrate-binding module (CBM). Specific calcium-dependent interactions between cohesins and dockerins appear to be essential for cellulosome assembly. This subfamily represents type I dockerins, which are responsible for anchoring a variety of enzymatic domains to the complex.
pfam16738	CBM26	2.25e-10	37	93	1	59	Starch-binding module 26. CBM26 is a carbohydrate-binding module that binds starch.
cd14253	Dockerin	9.52e-08	692	747	1	56	Dockerin repeat domain. Dockerins are modules in the cellulosome complex that often anchor catalytic subunits by binding to cohesin domains of scaffolding proteins. Three types of dockerins and their corresponding cohesin have been described in the literature. This alignment models two consecutive dockerin repeats, the functional unit.
PRK14081	PRK14081	4.11e-07	585	651	293	361	triple tyrosine motif-containing protein; Provisional
pfam00404	Dockerin_1	4.10e-06	692	746	1	55	Dockerin type I repeat. The dockerin repeat is the binding partner of the cohesin domain pfam00963. The cohesin-dockerin interaction is the crucial interaction for complex formation in the cellulosome. The dockerin repeats, each bearing homology to the EF-hand calcium-binding loop bind calcium.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCT06902.1	0.0	1	711	1	692
CDM67953.1	2.52e-99	46	650	583	1167
AWX97480.1	3.76e-81	33	659	550	1153
AWX95531.1	3.76e-81	33	659	550	1153
QCT07491.1	1.09e-65	1	571	1	528

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.029632	0.967941	0.000726	0.000868	0.000427	0.000374

TMHMM  Annotations     

start	end
7	29