CAZyme Information: MGYG000004337_00639

Basic Information

• Species: Phascolarctobacterium sp000436095
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Acidaminococcales; Acidaminococcaceae; Phascolarctobacterium; Phascolarctobacterium sp000436095
• CAZyme ID: MGYG000004337_00639
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
302	MGYG000004337_3|CGC2	34712.06	9.5787

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004337	1880847	MAG	Israel	Asia

• Gene Location: Start: 123542; End: 124450 Strand: -

Full Sequence      

MRRYGWWLFWGLAALLLFFGNGQLWITDSVESNYALTAKEMVLSGDWISPQIYGNYWYDK
PVFFYWLTAAGFKIFGFNEFAARFFPALFGMAGLWLLVYAAKKLYGEKTAFWSGVILMTS
TEFFLISKSVITDSTLFFFFSMALVFFYLGYSTQQKNYYYGMYIGMALATLTKGPIGFLL
PGLIMVLFLVFTRGWREIKNMKVFSGGLLFFLIAAPWYVAMYNLHGSAFIDQFFGTHNFL
RATVSEHPRDNVFYYYTLVLLLALFPWSGLLPRFLGEKLTARSTFGLLCLVIGMLLLVLP
PA

Enzyme Prediction     

No EC number prediction in MGYG000004337_00639.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	3	297	2.3e-90	0.5425925925925926

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	2.35e-40	12	300	16	306	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	3.27e-25	10	292	6	301	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam13231	PMT_2	3.81e-22	59	217	1	157	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
pfam02366	PMT	3.55e-08	31	222	32	235	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
COG1287	Stt3	4.50e-05	59	192	86	231	Asparagine N-glycosylation enzyme, membrane subunit Stt3 [Posttranslational modification, protein turnover, chaperones].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTV78033.1	6.19e-116	1	272	1	272
AEQ23377.1	2.31e-111	1	272	1	271
ADB46704.1	4.29e-109	1	279	1	278
AVO27725.1	1.22e-91	12	272	34	294
AXL22207.1	2.21e-91	13	272	40	300

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	3.11e-30	8	273	36	305	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O67270	5.02e-26	12	270	10	265	Uncharacterized protein aq_1220 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1220 PE=3 SV=1
Q02R27	1.01e-20	2	296	3	300	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) OX=208963 GN=arnT PE=3 SV=1
C5BDQ8	1.37e-20	24	286	27	290	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Edwardsiella ictaluri (strain 93-146) OX=634503 GN=arnT PE=3 SV=1
A6V1N8	3.38e-20	2	277	3	281	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pseudomonas aeruginosa (strain PA7) OX=381754 GN=arnT PE=3 SV=1
O67601	9.15e-20	12	263	11	248	Uncharacterized protein aq_1704 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1704 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.973638	0.025802	0.000373	0.000046	0.000043	0.000136

TMHMM  Annotations     

start	end
5	27
80	99
136	153
168	190
203	225
252	271
284	301