CAZyme Information: MGYG000004337_00843

Basic Information

• Species: Phascolarctobacterium sp000436095
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Acidaminococcales; Acidaminococcaceae; Phascolarctobacterium; Phascolarctobacterium sp000436095
• CAZyme ID: MGYG000004337_00843
• CAZy Family: GH23
• CAZyme Description: Soluble lytic murein transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
204	MGYG000004337_5|CGC2	24370.04	8.9806

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004337	1880847	MAG	Israel	Asia

• Gene Location: Start: 31261; End: 31875 Strand: +

Full Sequence      

MGRRKKKKFIDRWWVKFLMVAAAIFLIGEAGMKIWSSEAVQTRFVYMWPYQNEILEYSSK
NKIDPFLVAAVIKNESGFDTEAVSHAGAVGLMQIMPETGEWIASQMGLDHFDLEALRRPE
YNVRLGCWYLGELEYEFQRNWVLMMIAYNAGRGNTRAWMQENGWNYDFNRIEDIPYPDTR
EYVKKVLRDRDKYYLYYKNKIKNY

Enzyme Prediction     

No EC number prediction in MGYG000004337_00843.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	57	192	1.2e-29	0.8518518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	1.41e-74	48	192	2	146	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	1.05e-56	49	198	5	150	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	9.40e-38	65	188	1	108	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	9.00e-28	16	204	102	294	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
pfam01464	SLT	3.19e-25	54	164	1	108	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBG64618.1	1.86e-104	1	204	1	201
QNP77119.1	7.40e-102	13	204	26	212
QTV76946.1	1.91e-91	2	202	7	206
AEQ23289.1	5.27e-68	1	193	1	189
ADB46849.1	7.71e-68	18	204	13	199

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	3.28e-24	16	187	378	549	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	3.30e-24	16	187	382	553	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	3.34e-24	16	187	388	559	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	3.36e-24	16	187	392	563	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	3.38e-24	16	187	398	569	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AGC3	5.73e-18	9	197	451	628	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
P0AGC4	5.73e-18	9	197	451	628	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
P39434	9.01e-17	9	197	451	628	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
O31608	1.65e-15	52	186	62	175	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
O31976	1.92e-14	46	192	1418	1543	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.998482	0.001471	0.000021	0.000004	0.000003	0.000043

TMHMM  Annotations     

start	end
13	35